Detailed information
Bioinformatically predicted
Overview
| Name | comR | Type | Regulator |
| Locus tag | I872_RS05605 | Genome accession | NC_021175 |
| Coordinates | 1125169..1125390 (-) | Length | 73 a.a. |
| NCBI ID | WP_041826805.1 | Uniprot ID | - |
| Organism | Streptococcus cristatus AS 1.3089 | ||
| Function | activate transcription of comX; activate transcription of comS (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1120169..1130390
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I872_RS05580 (I872_05600) | - | 1121432..1121863 (-) | 432 | WP_015605171.1 | arginine repressor | - |
| I872_RS05585 (I872_05605) | - | 1121847..1122671 (-) | 825 | WP_015605172.1 | TlyA family RNA methyltransferase | - |
| I872_RS05590 (I872_05610) | - | 1122664..1123539 (-) | 876 | WP_015605173.1 | polyprenyl synthetase family protein | - |
| I872_RS05595 (I872_05615) | - | 1123536..1123748 (-) | 213 | WP_015605174.1 | exodeoxyribonuclease VII small subunit | - |
| I872_RS05600 (I872_05620) | xseA | 1123726..1125066 (-) | 1341 | WP_015605175.1 | exodeoxyribonuclease VII large subunit | - |
| I872_RS05605 (I872_05625) | comR | 1125169..1125390 (-) | 222 | WP_041826805.1 | helix-turn-helix domain-containing protein | Regulator |
| I872_RS05610 (I872_05630) | - | 1125611..1126453 (-) | 843 | WP_015605177.1 | NAD(P)H-hydrate dehydratase | - |
| I872_RS05615 (I872_05640) | - | 1127160..1127870 (-) | 711 | WP_041826806.1 | ABC transporter ATP-binding protein | - |
| I872_RS05620 (I872_05645) | - | 1127870..1128634 (-) | 765 | WP_015605180.1 | ABC transporter ATP-binding protein | - |
| I872_RS05625 (I872_05650) | - | 1128634..1129587 (-) | 954 | WP_015605181.1 | branched-chain amino acid ABC transporter permease | - |
Sequence
Protein
Download Length: 73 a.a. Molecular weight: 8599.09 Da Isoelectric Point: 8.0168
>NTDB_id=48526 I872_RS05605 WP_041826805.1 1125169..1125390(-) (comR) [Streptococcus cristatus AS 1.3089]
MSELRIAIGKKIRELREQRKMTRELLCEDETRLTVRQLARIEAGDSIPSLLTLEFIAQQLHIEMYQIIKESSK
MSELRIAIGKKIRELREQRKMTRELLCEDETRLTVRQLARIEAGDSIPSLLTLEFIAQQLHIEMYQIIKESSK
Nucleotide
Download Length: 222 bp
>NTDB_id=48526 I872_RS05605 WP_041826805.1 1125169..1125390(-) (comR) [Streptococcus cristatus AS 1.3089]
ATGTCAGAGTTAAGGATAGCAATTGGAAAAAAAATTAGAGAATTGAGGGAACAACGTAAAATGACAAGGGAATTGCTGTG
TGAGGATGAGACTCGTTTGACAGTCAGACAGCTTGCTCGGATCGAGGCAGGCGATTCGATTCCTAGTTTACTAACCTTAG
AATTCATTGCGCAGCAGTTGCACATCGAAATGTATCAAATTATCAAAGAAAGTTCCAAGTGA
ATGTCAGAGTTAAGGATAGCAATTGGAAAAAAAATTAGAGAATTGAGGGAACAACGTAAAATGACAAGGGAATTGCTGTG
TGAGGATGAGACTCGTTTGACAGTCAGACAGCTTGCTCGGATCGAGGCAGGCGATTCGATTCCTAGTTTACTAACCTTAG
AATTCATTGCGCAGCAGTTGCACATCGAAATGTATCAAATTATCAAAGAAAGTTCCAAGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comR | Streptococcus thermophilus LMD-9 |
44.928 |
94.521 |
0.425 |
| comR | Streptococcus salivarius strain HSISS4 |
42.857 |
95.89 |
0.411 |
| comR | Streptococcus thermophilus LMG 18311 |
43.478 |
94.521 |
0.411 |
| comR | Streptococcus salivarius SK126 |
50 |
79.452 |
0.397 |
| comR | Streptococcus pyogenes MGAS315 |
50.877 |
78.082 |
0.397 |
| comR | Streptococcus pyogenes MGAS8232 |
52.727 |
75.342 |
0.397 |
| comR | Streptococcus suis D9 |
44.444 |
86.301 |
0.384 |
| comR | Streptococcus suis 05ZYH33 |
44.444 |
86.301 |
0.384 |
| comR | Streptococcus suis P1/7 |
44.444 |
86.301 |
0.384 |
| comR/comR2 | Streptococcus sobrinus strain NIDR 6715-7 |
48.214 |
76.712 |
0.37 |
| comR/comR1 | Streptococcus sobrinus strain NIDR 6715-7 |
44.262 |
83.562 |
0.37 |