NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	IBL27_RS01065	Genome accession	NZ_CP061071
Coordinates	215057..215452 (+)	Length	131 a.a.
NCBI ID	WP_002263999.1	Uniprot ID	A0AAX1K1Y7
Organism	Streptococcus mutans B04Sm5
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 210057..220452

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IBL27_RS01025 (IBL27_01025)	-	210156..210818 (+)	663	WP_002263446.1	type II CAAX endopeptidase family protein	-
IBL27_RS01030 (IBL27_01030)	proC	210903..211673 (-)	771	WP_002263447.1	pyrroline-5-carboxylate reductase	-
IBL27_RS01035 (IBL27_01035)	pepA	211729..212796 (-)	1068	WP_002269918.1	glutamyl aminopeptidase	-
IBL27_RS01040 (IBL27_01040)	-	212856..213164 (+)	309	WP_002269917.1	DUF4651 domain-containing protein	-
IBL27_RS01045 (IBL27_01045)	-	213142..213471 (+)	330	WP_002269916.1	thioredoxin family protein	-
IBL27_RS01050 (IBL27_01050)	ytpR	213468..214094 (+)	627	WP_002288490.1	YtpR family tRNA-binding protein	-
IBL27_RS01055 (IBL27_01055)	-	214183..214614 (+)	432	WP_018110218.1	MarR family winged helix-turn-helix transcriptional regulator	-
IBL27_RS01060 (IBL27_01060)	-	214614..214970 (+)	357	WP_002288489.1	rhodanese-like domain-containing protein	-
IBL27_RS01065 (IBL27_01065)	ssbA	215057..215452 (+)	396	WP_002263999.1	single-stranded DNA-binding protein	Machinery gene
IBL27_RS01070 (IBL27_01070)	-	215868..216830 (+)	963	WP_002263455.1	sugar ABC transporter substrate-binding protein	-
IBL27_RS01075 (IBL27_01075)	-	216830..218152 (+)	1323	WP_002263456.1	sensor histidine kinase	-
IBL27_RS01080 (IBL27_01080)	-	218152..218832 (+)	681	WP_002263457.1	response regulator transcription factor	-
IBL27_RS01085 (IBL27_01085)	-	218825..220132 (+)	1308	WP_002309244.1	extracellular solute-binding protein	-
IBL27_RS01090 (IBL27_01090)	-	220198..220401 (+)	204	Protein_190	hypothetical protein	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14869.91 Da Isoelectric Point: 6.4856

                                >NTDB_id=480224 IBL27_RS01065 WP_002263999.1 215057..215452(+) (ssbA) [Streptococcus mutans B04Sm5]

MYNKVILIGRLVATPEMVKTPKDKSVTRVTLAVNRRFKSQDGERQADFVNVVLWGRLAETIASYGSKGSLISLDGELRTR

KYEKDGVTHFVTEVLGHSFQLLESRAQRAMRENNSENDLADLVLEEEELPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=480224 IBL27_RS01065 WP_002263999.1 215057..215452(+) (ssbA) [Streptococcus mutans B04Sm5]

ATGTATAATAAAGTTATTTTGATTGGTCGTTTAGTTGCGACACCTGAAATGGTAAAAACACCAAAGGATAAGTCTGTTAC

GCGCGTGACACTGGCTGTCAATCGGCGATTTAAAAGTCAAGATGGGGAAAGGCAGGCTGATTTTGTCAATGTTGTTCTTT

GGGGCAGATTGGCAGAAACAATAGCTTCCTATGGTAGTAAGGGAAGTCTCATCTCTCTTGATGGAGAATTGCGTACCCGT

AAATATGAAAAAGATGGCGTCACTCATTTTGTGACTGAAGTTTTGGGACACTCCTTTCAATTACTGGAAAGTCGTGCTCA

ACGTGCTATGCGTGAAAATAATTCTGAAAATGATTTGGCCGATTTGGTTCTAGAAGAGGAGGAACTCCCTTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-101)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	99.237	100	0.992
ssbB	Streptococcus sobrinus strain NIDR 6715-7	79.389	100	0.794
ssbB/cilA	Streptococcus pneumoniae TIGR4	76.336	100	0.763
ssbB/cilA	Streptococcus pneumoniae Rx1	75.573	100	0.756
ssbB/cilA	Streptococcus pneumoniae D39	75.573	100	0.756
ssbB/cilA	Streptococcus pneumoniae R6	75.573	100	0.756
ssbB/cilA	Streptococcus mitis SK321	75.573	100	0.756
ssbB/cilA	Streptococcus mitis NCTC 12261	74.046	100	0.74
ssbB	Lactococcus lactis subsp. cremoris KW2	58.929	85.496	0.504
ssbA	Bacillus subtilis subsp. subtilis str. 168	50.943	80.916	0.412
ssb	Latilactobacillus sakei subsp. sakei 23K	42.478	86.26	0.366

Detailed information NTG0480224