NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	H7795_RS00680	Genome accession	NZ_CP060641
Coordinates	105891..106217 (+)	Length	108 a.a.
NCBI ID	WP_032465607.1	Uniprot ID	-
Organism	Streptococcus pyogenes strain TSPY210
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 100891..111217

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H7795_RS00665 (H7795_00660)	-	103523..103888 (+)	366	WP_002986560.1	DUF1033 family protein	-
H7795_RS00670 (H7795_00665)	comYA	103981..104919 (+)	939	WP_023613135.1	competence type IV pilus ATPase ComGA	Machinery gene
H7795_RS00675 (H7795_00670)	comYB	104855..105889 (+)	1035	WP_258855794.1	competence type IV pilus assembly protein ComGB	Machinery gene
H7795_RS00680 (H7795_00675)	comYC	105891..106217 (+)	327	WP_032465607.1	competence type IV pilus major pilin ComGC	Machinery gene
H7795_RS00685 (H7795_00680)	comGD	106192..106620 (+)	429	WP_002986548.1	competence type IV pilus minor pilin ComGD	-
H7795_RS00690 (H7795_00685)	comGE	106577..106861 (+)	285	WP_002987779.1	competence type IV pilus minor pilin ComGE	-
H7795_RS00695 (H7795_00690)	comYF	106854..107288 (+)	435	WP_023612536.1	competence type IV pilus minor pilin ComGF	Machinery gene
H7795_RS00700 (H7795_00695)	comGG	107272..107598 (+)	327	WP_002992739.1	competence type IV pilus minor pilin ComGG	-
H7795_RS00705 (H7795_00700)	comYH	107696..108649 (+)	954	WP_002987790.1	class I SAM-dependent methyltransferase	Machinery gene
H7795_RS00710 (H7795_00705)	-	108708..109904 (+)	1197	WP_023612537.1	acetate kinase	-
H7795_RS00715 (H7795_00710)	-	110091..110399 (+)	309	WP_030126458.1	hypothetical protein	-

Sequence

Protein

Download Length: 108 a.a. Molecular weight: 12375.38 Da Isoelectric Point: 10.0732

                                >NTDB_id=477073 H7795_RS00680 WP_032465607.1 105891..106217(+) (comYC) [Streptococcus pyogenes strain TSPY210]

MINQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDRVTETGNAAVVKLVENQAELYELSQGSKPSLSQLKA

DGSITEKQEKAYQDYYNKHKNEKARLSN

Nucleotide

Download Length: 327 bp

                                >NTDB_id=477073 H7795_RS00680 WP_032465607.1 105891..106217(+) (comYC) [Streptococcus pyogenes strain TSPY210]

ATGATTAATCAATGGAACAACTTACGACACAAGAAGCTAAAAGGATTTACTCTTCTAGAAATGTTATTGGTGATTCTTGT

CATCAGTGTTTTGATGCTATTATTTGTGCCTAATTTAAGCAAGCAAAAAGACAGGGTTACAGAAACAGGTAATGCCGCTG

TTGTTAAATTAGTGGAGAATCAAGCAGAACTATATGAATTATCTCAAGGCTCAAAACCAAGTTTGAGCCAGTTAAAGGCA

GATGGTAGTATCACTGAGAAACAAGAAAAAGCTTATCAAGACTATTATAACAAACATAAAAATGAAAAAGCCCGTCTTAG

CAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(12-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus gordonii str. Challis substr. CH1	56.19	97.222	0.546
comGC/cglC	Streptococcus mitis SK321	61.957	85.185	0.528
comGC	Lactococcus lactis subsp. cremoris KW2	55.882	94.444	0.528
comGC/cglC	Streptococcus mitis NCTC 12261	60.87	85.185	0.519
comGC/cglC	Streptococcus pneumoniae TIGR4	59.783	85.185	0.509
comGC/cglC	Streptococcus pneumoniae Rx1	59.783	85.185	0.509
comGC/cglC	Streptococcus pneumoniae D39	59.783	85.185	0.509
comGC/cglC	Streptococcus pneumoniae R6	59.783	85.185	0.509
comYC	Streptococcus mutans UA140	55.208	88.889	0.491
comYC	Streptococcus mutans UA159	55.208	88.889	0.491
comYC	Streptococcus suis isolate S10	59.259	75	0.444

Detailed information NTG0477073