Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | HZF06_RS19295 | Genome accession | NZ_CP059378 |
| Coordinates | 3876709..3877128 (-) | Length | 139 a.a. |
| NCBI ID | WP_181601414.1 | Uniprot ID | A0A7D7A2B6 |
| Organism | Clostridium intestinale strain Lx1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3842965..3901566 | 3876709..3877128 | within | 0 |
Gene organization within MGE regions
Location: 3842965..3901566
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZF06_RS19110 (HZF06_19110) | secA | 3844148..3846664 (-) | 2517 | WP_181601384.1 | preprotein translocase subunit SecA | - |
| HZF06_RS19115 (HZF06_19115) | - | 3846821..3847669 (-) | 849 | WP_181601385.1 | DegV family protein | - |
| HZF06_RS19120 (HZF06_19120) | raiA | 3847795..3848337 (-) | 543 | WP_021800499.1 | ribosome-associated translation inhibitor RaiA | - |
| HZF06_RS19125 (HZF06_19125) | - | 3848903..3849493 (-) | 591 | WP_181601386.1 | SHOCT domain-containing protein | - |
| HZF06_RS19130 (HZF06_19130) | - | 3849596..3850216 (-) | 621 | WP_181601387.1 | hypothetical protein | - |
| HZF06_RS19135 (HZF06_19135) | - | 3850206..3850703 (-) | 498 | WP_207722158.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| HZF06_RS24210 | - | 3851100..3851708 (-) | 609 | WP_243186687.1 | SEC-C metal-binding domain-containing protein | - |
| HZF06_RS19145 (HZF06_19145) | - | 3851835..3852623 (-) | 789 | WP_181601388.1 | peptidoglycan-binding domain-containing protein | - |
| HZF06_RS19150 (HZF06_19150) | - | 3852681..3853013 (-) | 333 | WP_181601389.1 | hypothetical protein | - |
| HZF06_RS19155 (HZF06_19155) | - | 3853031..3853234 (-) | 204 | WP_181601390.1 | BhlA/UviB family holin-like peptide | - |
| HZF06_RS19160 (HZF06_19160) | - | 3853294..3853548 (-) | 255 | WP_243186778.1 | hypothetical protein | - |
| HZF06_RS19165 (HZF06_19165) | - | 3854016..3854306 (-) | 291 | WP_181601392.1 | hypothetical protein | - |
| HZF06_RS19170 (HZF06_19170) | - | 3854320..3858315 (-) | 3996 | WP_181601393.1 | hypothetical protein | - |
| HZF06_RS19175 (HZF06_19175) | - | 3858335..3858541 (-) | 207 | WP_181601394.1 | hypothetical protein | - |
| HZF06_RS19180 (HZF06_19180) | - | 3858557..3858907 (-) | 351 | WP_181601395.1 | DUF6711 family protein | - |
| HZF06_RS19185 (HZF06_19185) | - | 3858919..3861435 (-) | 2517 | WP_181601396.1 | hypothetical protein | - |
| HZF06_RS19190 (HZF06_19190) | - | 3861488..3861793 (-) | 306 | WP_084765043.1 | Gp15 family bacteriophage protein | - |
| HZF06_RS19195 (HZF06_19195) | - | 3861807..3862172 (-) | 366 | WP_021801069.1 | hypothetical protein | - |
| HZF06_RS19200 (HZF06_19200) | - | 3862187..3862936 (-) | 750 | WP_181601397.1 | Ig-like domain-containing protein | - |
| HZF06_RS19205 (HZF06_19205) | - | 3862947..3863333 (-) | 387 | WP_181601398.1 | minor capsid protein | - |
| HZF06_RS19210 (HZF06_19210) | - | 3863333..3863716 (-) | 384 | WP_181601399.1 | hypothetical protein | - |
| HZF06_RS19215 (HZF06_19215) | - | 3863713..3864039 (-) | 327 | WP_181601400.1 | hypothetical protein | - |
| HZF06_RS19220 (HZF06_19220) | - | 3864042..3864392 (-) | 351 | WP_181601401.1 | hypothetical protein | - |
| HZF06_RS19225 (HZF06_19225) | - | 3864427..3864660 (-) | 234 | WP_181601402.1 | hypothetical protein | - |
| HZF06_RS19230 (HZF06_19230) | - | 3864673..3865557 (-) | 885 | WP_181601403.1 | capsid protein | - |
| HZF06_RS19235 (HZF06_19235) | - | 3865581..3866174 (-) | 594 | WP_181601404.1 | hypothetical protein | - |
| HZF06_RS19240 (HZF06_19240) | - | 3866332..3866655 (+) | 324 | WP_181601405.1 | hypothetical protein | - |
| HZF06_RS19245 (HZF06_19245) | - | 3866717..3866884 (-) | 168 | WP_181601406.1 | CPCC family cysteine-rich protein | - |
| HZF06_RS24215 (HZF06_19250) | - | 3866889..3868532 (-) | 1644 | WP_181601407.1 | phage minor capsid protein | - |
| HZF06_RS19255 (HZF06_19255) | - | 3868516..3870036 (-) | 1521 | WP_243186688.1 | phage portal protein | - |
| HZF06_RS19260 (HZF06_19260) | - | 3870040..3871389 (-) | 1350 | WP_181601408.1 | terminase | - |
| HZF06_RS19265 (HZF06_19265) | - | 3871382..3871903 (-) | 522 | WP_181601409.1 | terminase small subunit | - |
| HZF06_RS19270 (HZF06_19270) | - | 3871957..3872472 (-) | 516 | WP_181601410.1 | hypothetical protein | - |
| HZF06_RS19275 (HZF06_19275) | - | 3872720..3873280 (-) | 561 | WP_181601411.1 | hypothetical protein | - |
| HZF06_RS19280 (HZF06_19280) | - | 3873298..3873453 (-) | 156 | WP_181601412.1 | hypothetical protein | - |
| HZF06_RS19285 (HZF06_19285) | - | 3873780..3876086 (-) | 2307 | WP_181601413.1 | phage/plasmid primase, P4 family | - |
| HZF06_RS19290 (HZF06_19290) | - | 3876106..3876690 (-) | 585 | WP_181603776.1 | ERCC4 domain-containing protein | - |
| HZF06_RS19295 (HZF06_19295) | ssbA | 3876709..3877128 (-) | 420 | WP_181601414.1 | single-stranded DNA-binding protein | Machinery gene |
| HZF06_RS19300 (HZF06_19300) | - | 3877218..3878096 (-) | 879 | WP_181601415.1 | DUF3102 domain-containing protein | - |
| HZF06_RS19305 (HZF06_19305) | - | 3878108..3879652 (-) | 1545 | WP_181601416.1 | PcfJ domain-containing protein | - |
| HZF06_RS19310 (HZF06_19310) | - | 3879663..3880076 (-) | 414 | WP_181601417.1 | hypothetical protein | - |
| HZF06_RS19315 (HZF06_19315) | - | 3880119..3883910 (-) | 3792 | WP_181601418.1 | metallophosphoesterase | - |
| HZF06_RS19320 (HZF06_19320) | - | 3883907..3884053 (-) | 147 | WP_181601419.1 | aspartyl-phosphate phosphatase Spo0E family protein | - |
| HZF06_RS19325 (HZF06_19325) | - | 3884050..3884235 (-) | 186 | WP_181601420.1 | hypothetical protein | - |
| HZF06_RS19330 (HZF06_19330) | - | 3884235..3885242 (-) | 1008 | WP_181601421.1 | hypothetical protein | - |
| HZF06_RS19335 (HZF06_19335) | - | 3885272..3885457 (-) | 186 | WP_181601422.1 | hypothetical protein | - |
| HZF06_RS19340 (HZF06_19340) | - | 3885429..3885590 (-) | 162 | WP_181601423.1 | hypothetical protein | - |
| HZF06_RS19345 (HZF06_19345) | - | 3885636..3885866 (-) | 231 | WP_181601424.1 | helix-turn-helix domain-containing protein | - |
| HZF06_RS19350 (HZF06_19350) | - | 3885885..3886115 (-) | 231 | WP_181601425.1 | helix-turn-helix transcriptional regulator | - |
| HZF06_RS19355 (HZF06_19355) | - | 3886349..3886777 (+) | 429 | WP_181601426.1 | helix-turn-helix transcriptional regulator | - |
| HZF06_RS19360 (HZF06_19360) | - | 3886791..3887225 (+) | 435 | WP_181601427.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HZF06_RS19365 (HZF06_19365) | - | 3887295..3887489 (+) | 195 | WP_181601428.1 | hypothetical protein | - |
| HZF06_RS19370 (HZF06_19370) | - | 3887523..3888722 (+) | 1200 | WP_181601429.1 | site-specific integrase | - |
| HZF06_RS19375 (HZF06_19375) | - | 3889047..3889724 (-) | 678 | WP_181601430.1 | ComF family protein | - |
| HZF06_RS19380 (HZF06_19380) | - | 3889697..3890713 (-) | 1017 | WP_181601431.1 | hypothetical protein | - |
| HZF06_RS19385 (HZF06_19385) | - | 3890729..3892957 (-) | 2229 | WP_021800496.1 | ATP-dependent RecD-like DNA helicase | - |
| HZF06_RS19390 (HZF06_19390) | nagA | 3893100..3894242 (+) | 1143 | WP_181601432.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| HZF06_RS19395 (HZF06_19395) | metK | 3894304..3895479 (-) | 1176 | WP_181601433.1 | methionine adenosyltransferase | - |
| HZF06_RS19440 (HZF06_19440) | - | 3896748..3897362 (-) | 615 | WP_181601434.1 | hypothetical protein | - |
| HZF06_RS19445 (HZF06_19445) | yyaC | 3897515..3898054 (+) | 540 | WP_073022500.1 | spore protease YyaC | - |
| HZF06_RS19450 (HZF06_19450) | mreB | 3898113..3899135 (-) | 1023 | WP_021800491.1 | rod shape-determining protein MreB | - |
| HZF06_RS19455 (HZF06_19455) | spoIIID | 3899228..3899479 (-) | 252 | WP_021800490.1 | sporulation transcriptional regulator SpoIIID | - |
| HZF06_RS19460 (HZF06_19460) | - | 3899580..3900347 (-) | 768 | WP_021800489.1 | M23 family metallopeptidase | - |
| HZF06_RS19465 (HZF06_19465) | spoIID | 3900514..3901566 (-) | 1053 | WP_181601435.1 | stage II sporulation protein D | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 14995.73 Da Isoelectric Point: 4.8779
>NTDB_id=469166 HZF06_RS19295 WP_181601414.1 3876709..3877128(-) (ssbA) [Clostridium intestinale strain Lx1]
MNKVVLIGRLTRDPELKFTPGNGTAVTSITLAVDKYNSATKQREADFISVTIWGKQAEATANYMTKGSLMAISGRIQTRT
YDDKEGNKRYVTEVVANETSFLSSKGNGAPGGANQTGNSISSWPEDDMVPVVDDGDIPF
MNKVVLIGRLTRDPELKFTPGNGTAVTSITLAVDKYNSATKQREADFISVTIWGKQAEATANYMTKGSLMAISGRIQTRT
YDDKEGNKRYVTEVVANETSFLSSKGNGAPGGANQTGNSISSWPEDDMVPVVDDGDIPF
Nucleotide
Download Length: 420 bp
>NTDB_id=469166 HZF06_RS19295 WP_181601414.1 3876709..3877128(-) (ssbA) [Clostridium intestinale strain Lx1]
ATGAATAAGGTAGTGCTTATAGGTAGATTAACGCGAGATCCAGAGCTTAAATTTACACCGGGAAATGGTACCGCAGTAAC
TAGCATAACTCTAGCAGTTGACAAATATAATTCTGCTACCAAGCAAAGAGAAGCTGATTTTATATCAGTTACTATATGGG
GTAAACAAGCCGAAGCTACAGCCAACTATATGACTAAGGGTAGCCTTATGGCTATAAGCGGAAGGATTCAGACAAGGACT
TATGATGATAAAGAAGGAAACAAGAGGTATGTAACAGAGGTTGTTGCTAATGAGACAAGCTTCTTGTCTAGCAAAGGCAA
TGGAGCTCCTGGAGGAGCGAATCAAACAGGTAACAGTATATCATCATGGCCAGAGGATGATATGGTGCCAGTTGTTGATG
ATGGCGACATACCATTTTAG
ATGAATAAGGTAGTGCTTATAGGTAGATTAACGCGAGATCCAGAGCTTAAATTTACACCGGGAAATGGTACCGCAGTAAC
TAGCATAACTCTAGCAGTTGACAAATATAATTCTGCTACCAAGCAAAGAGAAGCTGATTTTATATCAGTTACTATATGGG
GTAAACAAGCCGAAGCTACAGCCAACTATATGACTAAGGGTAGCCTTATGGCTATAAGCGGAAGGATTCAGACAAGGACT
TATGATGATAAAGAAGGAAACAAGAGGTATGTAACAGAGGTTGTTGCTAATGAGACAAGCTTCTTGTCTAGCAAAGGCAA
TGGAGCTCCTGGAGGAGCGAATCAAACAGGTAACAGTATATCATCATGGCCAGAGGATGATATGGTGCCAGTTGTTGATG
ATGGCGACATACCATTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
39.535 |
100 |
0.489 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.538 |
93.525 |
0.388 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
38.129 |
100 |
0.381 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.129 |
100 |
0.381 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
49.057 |
76.259 |
0.374 |
| ssbA | Streptococcus mutans UA159 |
37.143 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.41 |
100 |
0.374 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.41 |
100 |
0.374 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.113 |
76.259 |
0.367 |