Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | MS7_RS08330 | Genome accession | NC_017351 |
| Coordinates | 1653846..1654157 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus 11819-97 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1648846..1659157
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MS7_RS08295 (MS7_1553) | gcvPA | 1649348..1650694 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| MS7_RS08300 (MS7_1554) | gcvT | 1650714..1651805 (-) | 1092 | WP_000093353.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MS7_RS08305 (MS7_1555) | - | 1651964..1652488 (-) | 525 | WP_001015123.1 | shikimate kinase | - |
| MS7_RS08310 | - | 1652478..1652624 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| MS7_RS08315 (MS7_1556) | comGF | 1652721..1653218 (-) | 498 | WP_029263717.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| MS7_RS08320 (MS7_1557) | comGE | 1653136..1653435 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| MS7_RS08325 (MS7_1558) | comGD | 1653422..1653868 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MS7_RS08330 (MS7_1559) | comGC | 1653846..1654157 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| MS7_RS08335 (MS7_1560) | comGB | 1654171..1655241 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| MS7_RS08340 (MS7_1561) | comGA | 1655213..1656187 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| MS7_RS08345 (MS7_1562) | - | 1656239..1656862 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| MS7_RS08350 (MS7_1563) | - | 1656859..1657188 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| MS7_RS08355 (MS7_1564) | - | 1657188..1658174 (-) | 987 | WP_000161312.1 | ROK family glucokinase | - |
| MS7_RS08360 (MS7_1565) | - | 1658171..1658374 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=46646 MS7_RS08330 WP_000472256.1 1653846..1654157(-) (comGC) [Staphylococcus aureus subsp. aureus 11819-97]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=46646 MS7_RS08330 WP_000472256.1 1653846..1654157(-) (comGC) [Staphylococcus aureus subsp. aureus 11819-97]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |