Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SARLGA251_RS04295 | Genome accession | NC_017349 |
| Coordinates | 881127..881552 (+) | Length | 141 a.a. |
| NCBI ID | WP_000934780.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus LGA251 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 871874..917187 | 881127..881552 | within | 0 |
Gene organization within MGE regions
Location: 871874..917187
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SARLGA251_RS04215 (SARLGA251_07750) | sufB | 871874..873271 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| SARLGA251_RS04220 (SARLGA251_07760) | - | 873339..874388 (-) | 1050 | WP_001145730.1 | tyrosine-type recombinase/integrase | - |
| SARLGA251_RS04225 | - | 874500..874700 (+) | 201 | WP_000143212.1 | excisionase | - |
| SARLGA251_RS04230 (SARLGA251_07770) | - | 874637..875542 (-) | 906 | WP_000391592.1 | hypothetical protein | - |
| SARLGA251_RS04235 (SARLGA251_07780) | - | 875574..876212 (-) | 639 | WP_000874709.1 | XRE family transcriptional regulator | - |
| SARLGA251_RS04240 (SARLGA251_07790) | - | 876404..876658 (+) | 255 | WP_001106625.1 | helix-turn-helix domain-containing protein | - |
| SARLGA251_RS14630 (SARLGA251_07800) | - | 876674..876841 (+) | 168 | WP_000398749.1 | hypothetical protein | - |
| SARLGA251_RS04245 (SARLGA251_07810) | - | 876892..877374 (-) | 483 | WP_000394410.1 | hypothetical protein | - |
| SARLGA251_RS04250 | - | 877820..878005 (+) | 186 | WP_000933365.1 | helix-turn-helix domain-containing protein | - |
| SARLGA251_RS04255 (SARLGA251_07820) | - | 878007..878756 (+) | 750 | WP_001148639.1 | phage antirepressor KilAC domain-containing protein | - |
| SARLGA251_RS04260 | - | 878772..878975 (+) | 204 | Protein_811 | hypothetical protein | - |
| SARLGA251_RS04265 (SARLGA251_07830) | - | 878943..879188 (-) | 246 | WP_000122246.1 | hypothetical protein | - |
| SARLGA251_RS04270 (SARLGA251_07840) | - | 879259..879489 (+) | 231 | WP_000594787.1 | hypothetical protein | - |
| SARLGA251_RS04275 | - | 879473..879634 (+) | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
| SARLGA251_RS04280 (SARLGA251_07850) | - | 879736..879996 (+) | 261 | WP_000291103.1 | DUF1108 family protein | - |
| SARLGA251_RS04285 (SARLGA251_07860) | - | 880010..880489 (+) | 480 | WP_000002521.1 | siphovirus Gp157 family protein | - |
| SARLGA251_RS04290 (SARLGA251_07870) | - | 880489..881127 (+) | 639 | WP_001043066.1 | ERF family protein | - |
| SARLGA251_RS04295 (SARLGA251_07880) | ssbA | 881127..881552 (+) | 426 | WP_000934780.1 | single-stranded DNA-binding protein | Machinery gene |
| SARLGA251_RS04300 (SARLGA251_07890) | - | 881566..882240 (+) | 675 | WP_001121816.1 | putative HNHc nuclease | - |
| SARLGA251_RS04305 (SARLGA251_07900) | - | 882233..882985 (+) | 753 | WP_001037659.1 | DnaD domain protein | - |
| SARLGA251_RS04310 (SARLGA251_07910) | - | 882985..883341 (+) | 357 | WP_001132244.1 | hypothetical protein | - |
| SARLGA251_RS04315 (SARLGA251_07920) | - | 883338..884579 (+) | 1242 | WP_001106158.1 | DnaB helicase C-terminal domain-containing protein | - |
| SARLGA251_RS04320 (SARLGA251_07930) | - | 884576..884791 (+) | 216 | WP_001024400.1 | hypothetical protein | - |
| SARLGA251_RS04325 (SARLGA251_07940) | - | 884794..885015 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| SARLGA251_RS04330 (SARLGA251_07950) | - | 885025..885429 (+) | 405 | WP_000049792.1 | DUF1064 domain-containing protein | - |
| SARLGA251_RS04335 (SARLGA251_07960) | - | 885434..885619 (+) | 186 | WP_001187254.1 | DUF3113 family protein | - |
| SARLGA251_RS14075 (SARLGA251_07970) | - | 885620..886237 (+) | 618 | WP_000907417.1 | SA1788 family PVL leukocidin-associated protein | - |
| SARLGA251_RS04345 (SARLGA251_07980) | - | 886238..886486 (+) | 249 | WP_001124144.1 | phi PVL orf 51-like protein | - |
| SARLGA251_RS04350 (SARLGA251_07990) | - | 886500..886880 (+) | 381 | WP_000693985.1 | hypothetical protein | - |
| SARLGA251_RS14680 (SARLGA251_08000) | - | 886877..887071 (+) | 195 | WP_000983949.1 | hypothetical protein | - |
| SARLGA251_RS04360 (SARLGA251_08010) | - | 887068..887352 (+) | 285 | WP_001105605.1 | hypothetical protein | - |
| SARLGA251_RS04365 (SARLGA251_08020) | - | 887345..887593 (+) | 249 | WP_001065120.1 | DUF1024 family protein | - |
| SARLGA251_RS04370 (SARLGA251_08030) | - | 887586..888098 (+) | 513 | WP_000181820.1 | dUTP diphosphatase | - |
| SARLGA251_RS04375 (SARLGA251_08040) | - | 888135..888341 (+) | 207 | WP_000195825.1 | DUF1381 domain-containing protein | - |
| SARLGA251_RS04380 (SARLGA251_08050) | rinB | 888338..888511 (+) | 174 | WP_000595249.1 | transcriptional activator RinB | - |
| SARLGA251_RS04385 (SARLGA251_08060) | - | 888512..888658 (+) | 147 | WP_000989998.1 | hypothetical protein | - |
| SARLGA251_RS04390 (SARLGA251_08070) | - | 888682..889104 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| SARLGA251_RS04395 (SARLGA251_08080) | - | 889436..889930 (+) | 495 | WP_000594081.1 | terminase small subunit | - |
| SARLGA251_RS04400 (SARLGA251_08090) | - | 889923..891146 (+) | 1224 | WP_001037580.1 | PBSX family phage terminase large subunit | - |
| SARLGA251_RS04405 (SARLGA251_08100) | - | 891143..892567 (+) | 1425 | WP_078064613.1 | phage portal protein | - |
| SARLGA251_RS04410 (SARLGA251_08110) | - | 892536..893486 (+) | 951 | WP_000609643.1 | phage head morphogenesis protein | - |
| SARLGA251_RS04415 (SARLGA251_08120) | - | 893582..894166 (+) | 585 | WP_001019218.1 | DUF4355 domain-containing protein | - |
| SARLGA251_RS04420 (SARLGA251_08130) | - | 894183..895097 (+) | 915 | WP_000235170.1 | phage major capsid protein | - |
| SARLGA251_RS14620 (SARLGA251_08140) | - | 895109..895252 (+) | 144 | WP_000002930.1 | hypothetical protein | - |
| SARLGA251_RS04425 (SARLGA251_08150) | - | 895258..895608 (+) | 351 | WP_000177353.1 | phage head-tail adapter protein | - |
| SARLGA251_RS04430 (SARLGA251_08160) | - | 895620..895955 (+) | 336 | WP_000483039.1 | phage head closure protein | - |
| SARLGA251_RS04435 (SARLGA251_08170) | - | 895942..896355 (+) | 414 | WP_001151322.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SARLGA251_RS04440 (SARLGA251_08180) | - | 896368..896793 (+) | 426 | WP_000270192.1 | DUF3168 domain-containing protein | - |
| SARLGA251_RS04445 (SARLGA251_08190) | - | 896794..897351 (+) | 558 | WP_000057585.1 | hypothetical protein | - |
| SARLGA251_RS04450 (SARLGA251_08200) | - | 897418..897930 (+) | 513 | WP_000134338.1 | tail assembly chaperone | - |
| SARLGA251_RS14685 (SARLGA251_08210) | - | 898110..898259 (+) | 150 | WP_000090259.1 | hypothetical protein | - |
| SARLGA251_RS04460 (SARLGA251_08220) | - | 898263..901148 (+) | 2886 | WP_000379437.1 | phage tail protein | - |
| SARLGA251_RS04465 (SARLGA251_08230) | - | 901163..902104 (+) | 942 | WP_000560190.1 | phage tail domain-containing protein | - |
| SARLGA251_RS04470 (SARLGA251_08240) | - | 902115..904001 (+) | 1887 | WP_001122008.1 | SGNH/GDSL hydrolase family protein | - |
| SARLGA251_RS04475 (SARLGA251_08250) | - | 904014..905912 (+) | 1899 | WP_000323243.1 | hypothetical protein | - |
| SARLGA251_RS04480 (SARLGA251_08260) | - | 905912..907735 (+) | 1824 | WP_000259641.1 | phage baseplate upper protein | - |
| SARLGA251_RS04485 (SARLGA251_08270) | - | 907735..908121 (+) | 387 | WP_000705904.1 | DUF2977 domain-containing protein | - |
| SARLGA251_RS04490 (SARLGA251_08280) | - | 908114..908290 (+) | 177 | WP_000916018.1 | XkdX family protein | - |
| SARLGA251_RS04495 (SARLGA251_08290) | - | 908330..908635 (+) | 306 | WP_000467321.1 | DUF2951 family protein | - |
| SARLGA251_RS04500 (SARLGA251_08300) | - | 908772..910646 (+) | 1875 | WP_000524027.1 | glucosaminidase domain-containing protein | - |
| SARLGA251_RS14690 | - | 910659..911246 (+) | 588 | Protein_861 | phage baseplate upper protein | - |
| SARLGA251_RS14695 | - | 912534..913253 (+) | 720 | WP_231844697.1 | SGNH/GDSL hydrolase family protein | - |
| SARLGA251_RS04510 (SARLGA251_08320) | - | 913309..913746 (+) | 438 | WP_000354116.1 | phage holin | - |
| SARLGA251_RS04515 (SARLGA251_08330) | - | 913727..915172 (+) | 1446 | WP_001148144.1 | SH3 domain-containing protein | - |
| SARLGA251_RS04520 (SARLGA251_08340) | - | 916071..916250 (+) | 180 | WP_000201920.1 | hypothetical protein | - |
| SARLGA251_RS04525 (SARLGA251_08350) | - | 916272..916799 (+) | 528 | WP_000455173.1 | Panacea domain-containing protein | - |
| SARLGA251_RS04530 (SARLGA251_08360) | - | 916789..917187 (+) | 399 | WP_000557464.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15847.32 Da Isoelectric Point: 4.6952
>NTDB_id=46588 SARLGA251_RS04295 WP_000934780.1 881127..881552(+) (ssbA) [Staphylococcus aureus subsp. aureus LGA251]
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
MLNRTVLVGRLTKDPEYRTAPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=46588 SARLGA251_RS04295 WP_000934780.1 881127..881552(+) (ssbA) [Staphylococcus aureus subsp. aureus LGA251]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAGCGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
80.374 |
75.887 |
0.61 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.632 |
100 |
0.567 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
75.177 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.068 |
83.688 |
0.369 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.217 |
81.56 |
0.369 |
| ssbA | Streptococcus mutans UA159 |
44.348 |
81.56 |
0.362 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.22 |
83.688 |
0.362 |