Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SAOV_RS05595 | Genome accession | NC_017337 |
| Coordinates | 1115655..1116080 (+) | Length | 141 a.a. |
| NCBI ID | WP_000934776.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus ED133 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1107930..1148275 | 1115655..1116080 | within | 0 |
Gene organization within MGE regions
Location: 1107930..1148275
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAOV_RS05510 (SAOV_1070c) | - | 1107930..1109315 (-) | 1386 | WP_000861307.1 | recombinase family protein | - |
| SAOV_RS05515 (SAOV_1071c) | - | 1109368..1109703 (-) | 336 | WP_001292496.1 | hypothetical protein | - |
| SAOV_RS05520 (SAOV_1072c) | - | 1109705..1110208 (-) | 504 | WP_000428010.1 | hypothetical protein | - |
| SAOV_RS05525 (SAOV_1073c) | - | 1110244..1110429 (-) | 186 | WP_000100503.1 | hypothetical protein | - |
| SAOV_RS05530 (SAOV_1074c) | - | 1110584..1111294 (-) | 711 | WP_000094091.1 | helix-turn-helix domain-containing protein | - |
| SAOV_RS05535 (SAOV_1075) | - | 1111466..1111705 (+) | 240 | WP_000548577.1 | helix-turn-helix transcriptional regulator | - |
| SAOV_RS05540 (SAOV_1076) | - | 1111718..1112161 (+) | 444 | WP_000435360.1 | hypothetical protein | - |
| SAOV_RS05545 | - | 1112176..1112316 (+) | 141 | WP_000939495.1 | hypothetical protein | - |
| SAOV_RS05550 | - | 1112309..1112518 (-) | 210 | WP_000772137.1 | hypothetical protein | - |
| SAOV_RS05555 (SAOV_1077) | - | 1112575..1113288 (+) | 714 | WP_001157024.1 | phage repressor protein | - |
| SAOV_RS05560 | - | 1113452..1113682 (-) | 231 | WP_000395456.1 | hypothetical protein | - |
| SAOV_RS05565 | - | 1113754..1113975 (+) | 222 | WP_000594788.1 | hypothetical protein | - |
| SAOV_RS05570 (SAOV_1078) | - | 1113968..1114135 (+) | 168 | WP_000048122.1 | DUF1270 domain-containing protein | - |
| SAOV_RS05575 | - | 1114136..1114456 (+) | 321 | WP_000219663.1 | hypothetical protein | - |
| SAOV_RS05580 (SAOV_1079) | - | 1114548..1114808 (+) | 261 | WP_000291083.1 | DUF1108 family protein | - |
| SAOV_RS05585 (SAOV_1080) | - | 1114818..1115039 (+) | 222 | WP_001077279.1 | DUF2483 family protein | - |
| SAOV_RS05590 | - | 1115032..1115655 (+) | 624 | WP_000139724.1 | DUF1071 domain-containing protein | - |
| SAOV_RS05595 (SAOV_1081) | ssbA | 1115655..1116080 (+) | 426 | WP_000934776.1 | single-stranded DNA-binding protein | Machinery gene |
| SAOV_RS05600 | - | 1116094..1116768 (+) | 675 | WP_001121812.1 | putative HNHc nuclease | - |
| SAOV_RS05605 (SAOV_1082) | - | 1116761..1117513 (+) | 753 | WP_001037660.1 | DnaD domain protein | - |
| SAOV_RS05610 | - | 1117513..1117869 (+) | 357 | WP_001132243.1 | hypothetical protein | - |
| SAOV_RS05615 (SAOV_1083) | - | 1117866..1119107 (+) | 1242 | WP_001106164.1 | DnaB helicase C-terminal domain-containing protein | - |
| SAOV_RS05620 (SAOV_1084) | - | 1119104..1119319 (+) | 216 | WP_001024399.1 | hypothetical protein | - |
| SAOV_RS05625 | - | 1119322..1119543 (+) | 222 | WP_001123686.1 | DUF3269 family protein | - |
| SAOV_RS05630 (SAOV_1085) | - | 1119554..1119958 (+) | 405 | WP_000049785.1 | DUF1064 domain-containing protein | - |
| SAOV_RS05635 | - | 1119963..1120148 (+) | 186 | Protein_1090 | DUF3113 family protein | - |
| SAOV_RS05640 (SAOV_1086) | - | 1120149..1120520 (+) | 372 | WP_000248289.1 | SA1788 family PVL leukocidin-associated protein | - |
| SAOV_RS05645 (SAOV_1087) | - | 1120521..1120769 (+) | 249 | WP_001124144.1 | phi PVL orf 51-like protein | - |
| SAOV_RS05650 (SAOV_1088) | - | 1120783..1121031 (+) | 249 | WP_000693997.1 | hypothetical protein | - |
| SAOV_RS05655 (SAOV_1089) | - | 1120994..1121404 (+) | 411 | WP_000695751.1 | DUF4388 domain-containing protein | - |
| SAOV_RS05660 (SAOV_1090) | - | 1121404..1121679 (+) | 276 | WP_000399883.1 | hypothetical protein | - |
| SAOV_RS05665 (SAOV_1091) | - | 1121672..1121920 (+) | 249 | WP_001065117.1 | DUF1024 family protein | - |
| SAOV_RS05670 (SAOV_1092) | - | 1121913..1122425 (+) | 513 | WP_000181820.1 | dUTP diphosphatase | - |
| SAOV_RS05675 (SAOV_1093) | - | 1122462..1122704 (+) | 243 | WP_000028779.1 | hypothetical protein | - |
| SAOV_RS05680 (SAOV_1094) | - | 1122701..1122898 (+) | 198 | WP_000037315.1 | hypothetical protein | - |
| SAOV_RS05685 (SAOV_1095) | - | 1122898..1123104 (+) | 207 | WP_000195824.1 | DUF1381 domain-containing protein | - |
| SAOV_RS05690 (SAOV_1096) | rinB | 1123101..1123250 (+) | 150 | WP_000595242.1 | transcriptional activator RinB | - |
| SAOV_RS05695 (SAOV_1097) | - | 1123250..1123450 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| SAOV_RS05700 (SAOV_1098) | - | 1123478..1123894 (+) | 417 | WP_000590125.1 | hypothetical protein | - |
| SAOV_RS05705 (SAOV_1099) | - | 1124126..1124425 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
| SAOV_RS05710 (SAOV_1100) | - | 1124556..1124900 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| SAOV_RS05715 (SAOV_1101) | - | 1124897..1126558 (+) | 1662 | WP_000625098.1 | terminase large subunit | - |
| SAOV_RS05720 (SAOV_1102) | - | 1126574..1127761 (+) | 1188 | WP_000025269.1 | phage portal protein | - |
| SAOV_RS05725 (SAOV_1103) | - | 1127745..1128482 (+) | 738 | WP_000642731.1 | head maturation protease, ClpP-related | - |
| SAOV_RS05730 (SAOV_1104) | - | 1128506..1129651 (+) | 1146 | WP_000154571.1 | phage major capsid protein | - |
| SAOV_RS05735 (SAOV_1105) | - | 1129672..1129956 (+) | 285 | WP_001051388.1 | hypothetical protein | - |
| SAOV_RS05740 (SAOV_1106) | - | 1129946..1130230 (+) | 285 | WP_000952091.1 | phage head-tail connector protein | - |
| SAOV_RS05745 (SAOV_1107) | - | 1130214..1130576 (+) | 363 | WP_000755146.1 | head-tail adaptor protein | - |
| SAOV_RS05750 (SAOV_1108) | - | 1130573..1130977 (+) | 405 | WP_000114342.1 | HK97 gp10 family phage protein | - |
| SAOV_RS05755 (SAOV_1109) | - | 1130974..1131381 (+) | 408 | WP_000565501.1 | hypothetical protein | - |
| SAOV_RS05760 (SAOV_1110) | - | 1131382..1132023 (+) | 642 | WP_000268731.1 | major tail protein | - |
| SAOV_RS14870 (SAOV_1111) | - | 1132077..1132289 (+) | 213 | WP_236609278.1 | Ig-like domain-containing protein | - |
| SAOV_RS05765 (SAOV_1112) | gpG | 1132338..1132688 (+) | 351 | WP_001096356.1 | phage tail assembly chaperone G | - |
| SAOV_RS15455 (SAOV_1113) | gpGT | 1132739..1132876 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| SAOV_RS05775 (SAOV_1114) | - | 1132933..1137443 (+) | 4511 | Protein_1119 | phage tail tape measure protein | - |
| SAOV_RS05780 (SAOV_1116) | - | 1137440..1138924 (+) | 1485 | WP_000567409.1 | phage distal tail protein | - |
| SAOV_RS05785 (SAOV_1117) | - | 1138940..1142725 (+) | 3786 | WP_000582146.1 | phage tail spike protein | - |
| SAOV_RS05790 | - | 1142715..1142867 (+) | 153 | WP_001153680.1 | hypothetical protein | - |
| SAOV_RS05795 (SAOV_1118) | - | 1142914..1143201 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| SAOV_RS14530 (SAOV_1119) | - | 1143257..1143664 (+) | 408 | WP_000343513.1 | hypothetical protein | - |
| SAOV_RS05800 (SAOV_1120) | - | 1144119..1144898 (+) | 780 | WP_000746437.1 | exotoxin | - |
| SAOV_RS14875 | pepG1 | 1145141..1145275 (+) | 135 | WP_000226107.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SAOV_RS15315 | - | 1145324..1145427 (-) | 104 | Protein_1127 | hypothetical protein | - |
| SAOV_RS05810 (SAOV_1121) | - | 1145478..1145915 (+) | 438 | WP_000354124.1 | phage holin | - |
| SAOV_RS05815 (SAOV_1122) | - | 1145896..1146504 (+) | 609 | Protein_1129 | CHAP domain-containing protein | - |
| SAOV_RS05820 (SAOV_1123) | - | 1146567..1147112 (+) | 546 | WP_000136401.1 | NUMOD4 motif-containing HNH endonuclease | - |
| SAOV_RS05825 (SAOV_1124) | - | 1147424..1148275 (+) | 852 | Protein_1131 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15867.52 Da Isoelectric Point: 8.4724
>NTDB_id=46286 SAOV_RS05595 WP_000934776.1 1115655..1116080(+) (ssbA) [Staphylococcus aureus subsp. aureus ED133]
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKDGKRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTEADFSDLPF
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKDGKRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTEADFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=46286 SAOV_RS05595 WP_000934776.1 1115655..1116080(+) (ssbA) [Staphylococcus aureus subsp. aureus ED133]
ATGTTAAACAGAACAGTATTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGC
AGTTACGATAACAAAGACGGGAAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAG
CAGACTTTTCTGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGATTACAAACACGC
AGTTACGATAACAAAGACGGGAAACGTGTATTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAG
CAGACTTTTCTGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
72.881 |
83.688 |
0.61 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.632 |
100 |
0.567 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.957 |
81.56 |
0.383 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
81.56 |
0.383 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.22 |
83.688 |
0.362 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.22 |
83.688 |
0.362 |