Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   HSZ50_RS09350 Genome accession   NZ_CP054575
Coordinates   1894582..1895148 (-) Length   188 a.a.
NCBI ID   WP_011303464.1    Uniprot ID   Q49WF9
Organism   Staphylococcus saprophyticus strain UTI-050     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1851232..1894120 1894582..1895148 flank 462


Gene organization within MGE regions


Location: 1851232..1895148
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HSZ50_RS09015 (HSZ50_09015) - 1851232..1851429 (-) 198 WP_174605000.1 hypothetical protein -
  HSZ50_RS09020 (HSZ50_09020) - 1851809..1852219 (-) 411 WP_174605001.1 YolD-like family protein -
  HSZ50_RS09025 (HSZ50_09025) - 1852319..1852714 (-) 396 WP_258533621.1 hypothetical protein -
  HSZ50_RS09030 (HSZ50_09030) - 1852701..1853012 (-) 312 WP_174605002.1 DUF3467 domain-containing protein -
  HSZ50_RS09035 (HSZ50_09035) - 1853285..1855015 (-) 1731 WP_174605003.1 N-acetylmuramoyl-L-alanine amidase family protein -
  HSZ50_RS09040 (HSZ50_09040) - 1855012..1855317 (-) 306 WP_069795294.1 holin -
  HSZ50_RS09045 (HSZ50_09045) - 1855368..1855586 (-) 219 WP_174605004.1 hypothetical protein -
  HSZ50_RS09050 (HSZ50_09050) - 1855588..1856292 (-) 705 WP_174605005.1 hypothetical protein -
  HSZ50_RS09055 (HSZ50_09055) - 1856296..1857006 (-) 711 WP_220094583.1 BppU family phage baseplate upper protein -
  HSZ50_RS09060 (HSZ50_09060) - 1857053..1857451 (-) 399 WP_174605006.1 hypothetical protein -
  HSZ50_RS09065 (HSZ50_09065) - 1857438..1857860 (-) 423 WP_174605007.1 hypothetical protein -
  HSZ50_RS09070 (HSZ50_09070) - 1857915..1859822 (-) 1908 WP_174605008.1 glucosaminidase domain-containing protein -
  HSZ50_RS09075 (HSZ50_09075) - 1859882..1860505 (-) 624 WP_174605009.1 poly-gamma-glutamate hydrolase family protein -
  HSZ50_RS09080 (HSZ50_09080) - 1860519..1861862 (-) 1344 WP_174605010.1 BppU family phage baseplate upper protein -
  HSZ50_RS09085 (HSZ50_09085) - 1861875..1863743 (-) 1869 WP_174605011.1 M14 family metallopeptidase -
  HSZ50_RS09090 (HSZ50_09090) - 1863743..1865206 (-) 1464 WP_174605012.1 phage tail protein -
  HSZ50_RS09095 (HSZ50_09095) - 1865215..1866162 (-) 948 WP_145461869.1 phage tail domain-containing protein -
  HSZ50_RS09100 (HSZ50_09100) - 1866174..1869944 (-) 3771 WP_174605013.1 phage tail protein -
  HSZ50_RS09105 (HSZ50_09105) - 1869962..1870306 (-) 345 WP_129334834.1 hypothetical protein -
  HSZ50_RS09110 (HSZ50_09110) - 1870348..1870713 (-) 366 WP_129334833.1 tail assembly chaperone -
  HSZ50_RS09115 (HSZ50_09115) - 1870781..1871329 (-) 549 WP_174605014.1 phage major tail protein, TP901-1 family -
  HSZ50_RS09120 (HSZ50_09120) - 1871389..1871778 (-) 390 WP_174605015.1 hypothetical protein -
  HSZ50_RS09125 (HSZ50_09125) - 1871790..1872137 (-) 348 WP_174605016.1 HK97-gp10 family putative phage morphogenesis protein -
  HSZ50_RS09130 (HSZ50_09130) - 1872137..1872439 (-) 303 WP_174605017.1 hypothetical protein -
  HSZ50_RS09135 (HSZ50_09135) - 1872436..1872771 (-) 336 WP_174605018.1 phage head-tail connector protein -
  HSZ50_RS09140 (HSZ50_09140) - 1872773..1873042 (-) 270 WP_129334828.1 hypothetical protein -
  HSZ50_RS09145 (HSZ50_09145) - 1873058..1873969 (-) 912 WP_174605019.1 phage major capsid protein -
  HSZ50_RS09150 (HSZ50_09150) - 1873986..1874615 (-) 630 WP_145461874.1 DUF4355 domain-containing protein -
  HSZ50_RS09155 (HSZ50_09155) - 1874863..1875003 (-) 141 WP_174605020.1 hypothetical protein -
  HSZ50_RS09160 (HSZ50_09160) - 1875016..1875978 (-) 963 WP_145461882.1 minor capsid protein -
  HSZ50_RS09165 (HSZ50_09165) - 1875985..1877520 (-) 1536 WP_174605021.1 phage portal protein -
  HSZ50_RS09170 (HSZ50_09170) - 1877532..1878812 (-) 1281 WP_069796326.1 PBSX family phage terminase large subunit -
  HSZ50_RS09175 (HSZ50_09175) - 1878793..1879227 (-) 435 WP_069796327.1 HNH endonuclease -
  HSZ50_RS09180 (HSZ50_09180) - 1879402..1879842 (-) 441 WP_069796328.1 transcriptional regulator -
  HSZ50_RS09185 (HSZ50_09185) rinB 1879958..1880089 (-) 132 WP_141709937.1 transcriptional activator RinB -
  HSZ50_RS09190 (HSZ50_09190) - 1880107..1880322 (-) 216 WP_069796329.1 DUF1381 domain-containing protein -
  HSZ50_RS09195 (HSZ50_09195) - 1880526..1881047 (-) 522 WP_069796330.1 dUTP diphosphatase -
  HSZ50_RS09200 (HSZ50_09200) - 1881040..1881288 (-) 249 WP_069796331.1 hypothetical protein -
  HSZ50_RS09205 (HSZ50_09205) - 1881278..1881583 (-) 306 WP_069796332.1 hypothetical protein -
  HSZ50_RS09210 (HSZ50_09210) - 1881679..1882191 (-) 513 WP_069796333.1 hypothetical protein -
  HSZ50_RS09215 (HSZ50_09215) - 1882206..1882481 (-) 276 WP_061050558.1 hypothetical protein -
  HSZ50_RS09220 (HSZ50_09220) - 1882496..1882705 (-) 210 WP_061050557.1 hypothetical protein -
  HSZ50_RS09225 (HSZ50_09225) - 1882711..1882896 (-) 186 WP_061050556.1 Lar family restriction alleviation protein -
  HSZ50_RS09230 (HSZ50_09230) - 1883097..1883402 (-) 306 WP_069973593.1 DUF1140 family protein -
  HSZ50_RS13710 - 1883403..1884095 (-) 693 WP_309474090.1 DUF3310 domain-containing protein -
  HSZ50_RS09240 (HSZ50_09240) - 1884095..1884472 (-) 378 WP_069796335.1 SA1788 family PVL leukocidin-associated protein -
  HSZ50_RS09245 (HSZ50_09245) - 1884486..1884689 (-) 204 WP_069796336.1 hypothetical protein -
  HSZ50_RS09250 (HSZ50_09250) - 1884649..1885092 (-) 444 WP_069796337.1 RusA family crossover junction endodeoxyribonuclease -
  HSZ50_RS09255 (HSZ50_09255) - 1885103..1885324 (-) 222 WP_069796338.1 DUF3269 family protein -
  HSZ50_RS13610 - 1885325..1885486 (-) 162 WP_256107960.1 hypothetical protein -
  HSZ50_RS09260 (HSZ50_09260) - 1885483..1886268 (-) 786 WP_069796339.1 ATP-binding protein -
  HSZ50_RS09265 (HSZ50_09265) - 1886280..1887068 (-) 789 WP_069796340.1 phage replisome organizer N-terminal domain-containing protein -
  HSZ50_RS09270 (HSZ50_09270) - 1887040..1887306 (-) 267 WP_069796341.1 helix-turn-helix transcriptional regulator -
  HSZ50_RS09275 (HSZ50_09275) - 1887303..1887971 (-) 669 WP_174605022.1 putative HNHc nuclease -
  HSZ50_RS09280 (HSZ50_09280) ssbA 1887985..1888425 (-) 441 WP_145441193.1 single-stranded DNA-binding protein Machinery gene
  HSZ50_RS09285 (HSZ50_09285) - 1888422..1889066 (-) 645 WP_145441195.1 ERF family protein -
  HSZ50_RS09290 (HSZ50_09290) - 1889067..1889558 (-) 492 WP_145441197.1 siphovirus Gp157 family protein -
  HSZ50_RS09295 (HSZ50_09295) - 1889635..1889793 (-) 159 WP_174605023.1 hypothetical protein -
  HSZ50_RS09300 (HSZ50_09300) - 1889795..1890001 (-) 207 WP_174605024.1 hypothetical protein -
  HSZ50_RS09305 (HSZ50_09305) - 1890014..1890223 (-) 210 WP_174605025.1 DUF771 domain-containing protein -
  HSZ50_RS09310 (HSZ50_09310) - 1890213..1890791 (-) 579 WP_174605026.1 hypothetical protein -
  HSZ50_RS09315 (HSZ50_09315) - 1890827..1891045 (-) 219 WP_174605027.1 helix-turn-helix domain-containing protein -
  HSZ50_RS09320 (HSZ50_09320) - 1891207..1891524 (+) 318 WP_174605028.1 helix-turn-helix domain-containing protein -
  HSZ50_RS09325 (HSZ50_09325) - 1891499..1892014 (+) 516 WP_309474091.1 ImmA/IrrE family metallo-endopeptidase -
  HSZ50_RS09330 (HSZ50_09330) - 1892011..1892988 (+) 978 WP_174605029.1 DUF5067 domain-containing protein -
  HSZ50_RS09335 (HSZ50_09335) - 1893047..1894120 (+) 1074 WP_174605030.1 tyrosine-type recombinase/integrase -
  HSZ50_RS09350 (HSZ50_09350) comK/comK1 1894582..1895148 (-) 567 WP_011303464.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 188 a.a.        Molecular weight: 22095.50 Da        Isoelectric Point: 9.5132

>NTDB_id=453611 HSZ50_RS09350 WP_011303464.1 1894582..1895148(-) (comK/comK1) [Staphylococcus saprophyticus strain UTI-050]
MIQPYIIKKGDMVLQPCSLSTGKYEGSYLLKYKDDSKVLKERVPKIIDRSCRFYGSSYNFKKEDTMRITGISSKPPILFT
PLFPTYFFPTHSDRKEENTWINIHYVHQIKPLKEKKCKVTFVDNQTIVANISAHSMHHQYLNGIYYYYMMDRAARVATFD
PESPIDYTKPQLNIYEALAKYSLFENKS

Nucleotide


Download         Length: 567 bp        

>NTDB_id=453611 HSZ50_RS09350 WP_011303464.1 1894582..1895148(-) (comK/comK1) [Staphylococcus saprophyticus strain UTI-050]
ATGATTCAACCCTATATCATTAAAAAAGGGGATATGGTTTTACAACCATGCAGTTTATCAACTGGTAAGTATGAAGGTAG
TTATCTTTTAAAGTATAAGGATGACAGCAAAGTTCTAAAAGAACGTGTTCCAAAGATTATTGATCGATCGTGTAGATTTT
ATGGTAGTAGTTATAATTTTAAGAAAGAAGATACGATGAGAATTACTGGCATAAGCAGTAAACCCCCAATTTTATTTACT
CCACTTTTTCCTACTTATTTTTTCCCAACGCACTCTGATAGAAAAGAAGAAAATACTTGGATTAATATTCATTATGTTCA
CCAAATCAAACCACTAAAAGAAAAGAAATGTAAAGTGACATTTGTAGATAATCAAACAATTGTAGCTAACATTTCAGCAC
ATAGCATGCATCATCAATACCTAAATGGTATTTATTATTACTATATGATGGATAGGGCAGCAAGAGTTGCTACCTTTGAT
CCAGAATCTCCTATTGATTATACAAAACCTCAATTAAATATTTATGAAGCATTAGCAAAATATTCATTATTTGAAAATAA
ATCATAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(4-152)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q49WF9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

54.891

97.872

0.537
  comK/comK1 Staphylococcus aureus N315

54.891

97.872

0.537