NTDB

Overview

Name	ssbB	Type	Machinery gene
Locus tag	GE022_RS00930	Genome accession	NZ_CP053790
Coordinates	152128..152523 (+)	Length	131 a.a.
NCBI ID	WP_003046216.1	Uniprot ID	A0A2D4DQK2
Organism	Streptococcus canis strain HL_77_2
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 147128..157523

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GE022_RS00890 (GE022_000890)	-	147336..147542 (+)	207	WP_164405634.1	helix-turn-helix transcriptional regulator	-
GE022_RS00895 (GE022_000895)	-	147543..147683 (+)	141	Protein_131	type II CAAX prenyl endopeptidase Rce1 family protein	-
GE022_RS10595	-	147701..148138 (+)	438	WP_164228326.1	hypothetical protein	-
GE022_RS00905 (GE022_000905)	proC	148278..149054 (-)	777	WP_164405633.1	pyrroline-5-carboxylate reductase	-
GE022_RS00910 (GE022_000910)	pepA	149102..150169 (-)	1068	WP_164228328.1	glutamyl aminopeptidase	-
GE022_RS00915 (GE022_000915)	-	150734..151012 (+)	279	WP_003046210.1	DUF4651 domain-containing protein	-
GE022_RS00920 (GE022_000920)	-	151015..151332 (+)	318	WP_003046212.1	thioredoxin family protein	-
GE022_RS00925 (GE022_000925)	ytpR	151351..151977 (+)	627	WP_164228334.1	YtpR family tRNA-binding protein	-
GE022_RS00930 (GE022_000930)	ssbB	152128..152523 (+)	396	WP_003046216.1	single-stranded DNA-binding protein	Machinery gene
GE022_RS00935 (GE022_000935)	-	153072..153713 (-)	642	WP_003046220.1	deoxynucleoside kinase	-
GE022_RS00940 (GE022_000940)	dusB	153733..154710 (-)	978	WP_003046221.1	tRNA dihydrouridine synthase DusB	-
GE022_RS00945 (GE022_000945)	hslO	154697..155569 (-)	873	WP_164405632.1	Hsp33 family molecular chaperone HslO	-
GE022_RS00950 (GE022_000950)	-	155764..156975 (-)	1212	WP_003046224.1	YSIRK-targeted surface antigen transcriptional regulator	-

Sequence

Protein

Download Length: 131 a.a. Molecular weight: 14819.03 Da Isoelectric Point: 7.1668

                                >NTDB_id=447198 GE022_RS00930 WP_003046216.1 152128..152523(+) (ssbB) [Streptococcus canis strain HL_77_2]

MYNKVIMIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGEREADFISVVVWGKLAETLVSYASKGSLMSIDGELRTR

KYDKDGQVHYVTEVLCQSFQLLESRAQRAMRENNVASDLVDLVLEEEDLPF

Nucleotide

Download Length: 396 bp

                                >NTDB_id=447198 GE022_RS00930 WP_003046216.1 152128..152523(+) (ssbB) [Streptococcus canis strain HL_77_2]

ATGTATAATAAAGTAATCATGATTGGTCGTTTGGTGGCTAAACCTGAATTGGTAAAAACAGCTACGGATAAGCATGTGGC

GCGTCTATCTTTGGCTGTTAATCGGAGGTTCAAGAATGCTTCAGGAGAGCGAGAAGCTGATTTTATTTCTGTTGTTGTCT

GGGGAAAGTTGGCAGAAACTCTGGTTTCTTATGCCAGTAAAGGTAGTTTGATGTCTATTGATGGCGAGCTTAGAACCCGC

AAATATGATAAAGATGGGCAAGTGCATTATGTGACGGAAGTGCTATGTCAGTCCTTTCAGTTATTAGAAAGCCGTGCTCA

GCGTGCAATGCGAGAAAATAATGTGGCCAGTGACTTGGTGGATTTGGTCTTGGAAGAGGAGGACTTGCCTTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A2D4DQK2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbB	Streptococcus sobrinus strain NIDR 6715-7	74.809	100	0.748
ssbA	Streptococcus mutans UA159	74.046	100	0.74
ssbB/cilA	Streptococcus pneumoniae Rx1	71.756	100	0.718
ssbB/cilA	Streptococcus pneumoniae D39	71.756	100	0.718
ssbB/cilA	Streptococcus pneumoniae R6	71.756	100	0.718
ssbB/cilA	Streptococcus mitis NCTC 12261	71.756	100	0.718
ssbB/cilA	Streptococcus pneumoniae TIGR4	70.992	100	0.71
ssbB/cilA	Streptococcus mitis SK321	70.229	100	0.702
ssbB	Lactococcus lactis subsp. cremoris KW2	61.207	88.55	0.542
ssb	Latilactobacillus sakei subsp. sakei 23K	46.61	90.076	0.42
ssbA	Bacillus subtilis subsp. subtilis str. 168	49.057	80.916	0.397

Detailed information NTG0447198