Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HN015_RS03190 | Genome accession | NZ_CP053421 |
| Coordinates | 663383..663808 (+) | Length | 141 a.a. |
| NCBI ID | WP_166481378.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain PMC65 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 653226..708819 | 663383..663808 | within | 0 |
Gene organization within MGE regions
Location: 653226..708819
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HN015_RS03110 (HN015_03125) | - | 653226..653915 (-) | 690 | WP_008842223.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| HN015_RS03115 (HN015_03130) | - | 654311..655390 (-) | 1080 | WP_166481369.1 | tyrosine-type recombinase/integrase | - |
| HN015_RS03120 (HN015_03135) | - | 655526..656527 (-) | 1002 | WP_166481370.1 | Abi family protein | - |
| HN015_RS03125 (HN015_03140) | - | 657057..657254 (-) | 198 | WP_166481371.1 | hypothetical protein | - |
| HN015_RS03130 (HN015_03145) | - | 657488..657838 (-) | 351 | WP_159218511.1 | hypothetical protein | - |
| HN015_RS03135 (HN015_03150) | - | 657899..658306 (-) | 408 | WP_128212081.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HN015_RS03140 (HN015_03155) | - | 658315..658656 (-) | 342 | WP_002831842.1 | helix-turn-helix domain-containing protein | - |
| HN015_RS03145 (HN015_03160) | - | 658913..659119 (+) | 207 | WP_159215549.1 | hypothetical protein | - |
| HN015_RS03150 (HN015_03165) | - | 659109..659417 (-) | 309 | WP_166481373.1 | hypothetical protein | - |
| HN015_RS03155 (HN015_03170) | - | 659476..659694 (+) | 219 | WP_002833157.1 | helix-turn-helix domain-containing protein | - |
| HN015_RS03160 (HN015_03175) | - | 659879..660082 (-) | 204 | WP_029258004.1 | hypothetical protein | - |
| HN015_RS03165 (HN015_03180) | - | 660140..660907 (+) | 768 | WP_166481374.1 | phage antirepressor | - |
| HN015_RS03170 (HN015_03185) | - | 660920..661126 (+) | 207 | WP_166481375.1 | hypothetical protein | - |
| HN015_RS03175 (HN015_03190) | - | 661393..662010 (-) | 618 | WP_159209346.1 | hypothetical protein | - |
| HN015_RS03180 (HN015_03195) | - | 662236..662691 (+) | 456 | WP_166481376.1 | chromosome segregation protein SMC | - |
| HN015_RS03185 (HN015_03200) | - | 662692..663390 (+) | 699 | WP_166481377.1 | ERF family protein | - |
| HN015_RS03190 (HN015_03205) | ssb | 663383..663808 (+) | 426 | WP_166481378.1 | single-stranded DNA-binding protein | Machinery gene |
| HN015_RS03195 (HN015_03210) | - | 663820..664497 (+) | 678 | WP_128472133.1 | putative HNHc nuclease | - |
| HN015_RS03200 (HN015_03215) | - | 664487..664711 (+) | 225 | WP_128472134.1 | hypothetical protein | - |
| HN015_RS03205 (HN015_03220) | - | 664715..664963 (-) | 249 | WP_128472135.1 | hypothetical protein | - |
| HN015_RS03210 (HN015_03225) | - | 664997..665758 (+) | 762 | WP_128472136.1 | conserved phage C-terminal domain-containing protein | - |
| HN015_RS03215 (HN015_03230) | - | 665739..666554 (+) | 816 | WP_166481379.1 | ATP-binding protein | - |
| HN015_RS03220 (HN015_03235) | - | 666672..667304 (+) | 633 | WP_166481380.1 | RNA polymerase subunit sigma-70 | - |
| HN015_RS03225 (HN015_03240) | - | 667285..667686 (+) | 402 | WP_166481381.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HN015_RS03230 (HN015_03245) | - | 667683..667847 (+) | 165 | WP_166481382.1 | hypothetical protein | - |
| HN015_RS03235 (HN015_03250) | - | 667819..668187 (+) | 369 | WP_166481383.1 | N-acetylmuramoyl-L-alanine amidase | - |
| HN015_RS03240 (HN015_03255) | - | 668272..668706 (+) | 435 | WP_166481384.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| HN015_RS03245 (HN015_03260) | - | 669248..669400 (+) | 153 | WP_166481385.1 | hypothetical protein | - |
| HN015_RS03250 (HN015_03265) | - | 669369..669881 (+) | 513 | WP_166481386.1 | HNH endonuclease | - |
| HN015_RS03255 (HN015_03270) | - | 669979..670236 (+) | 258 | WP_166481387.1 | hypothetical protein | - |
| HN015_RS03260 (HN015_03275) | - | 670427..670885 (+) | 459 | WP_166481388.1 | phage terminase small subunit P27 family | - |
| HN015_RS03265 (HN015_03280) | - | 670888..672786 (+) | 1899 | WP_166481389.1 | terminase large subunit | - |
| HN015_RS03270 (HN015_03285) | - | 672776..672970 (+) | 195 | WP_024863127.1 | DUF1056 family protein | - |
| HN015_RS03275 (HN015_03290) | - | 672973..674166 (+) | 1194 | WP_166481390.1 | phage portal protein | - |
| HN015_RS03280 (HN015_03295) | - | 674144..674893 (+) | 750 | WP_159209379.1 | head maturation protease, ClpP-related | - |
| HN015_RS03285 (HN015_03300) | - | 674893..676125 (+) | 1233 | WP_166481391.1 | phage major capsid protein | - |
| HN015_RS03290 (HN015_03305) | - | 676198..676530 (+) | 333 | WP_024863131.1 | head-tail connector protein | - |
| HN015_RS03295 (HN015_03310) | - | 676520..676867 (+) | 348 | WP_171461264.1 | phage head closure protein | - |
| HN015_RS03300 (HN015_03315) | - | 676870..677277 (+) | 408 | WP_166481393.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| HN015_RS03305 (HN015_03320) | - | 677277..677657 (+) | 381 | WP_166481394.1 | DUF806 family protein | - |
| HN015_RS03310 (HN015_03325) | - | 677671..678375 (+) | 705 | WP_166481395.1 | phage tail protein | - |
| HN015_RS03315 (HN015_03330) | - | 678452..678826 (+) | 375 | WP_159209317.1 | phage tail assembly chaperone | - |
| HN015_RS03320 (HN015_03335) | - | 678871..679056 (+) | 186 | WP_053905877.1 | hypothetical protein | - |
| HN015_RS03325 (HN015_03340) | - | 679086..683741 (+) | 4656 | WP_166481396.1 | tape measure protein | - |
| HN015_RS03330 (HN015_03345) | - | 683818..685587 (+) | 1770 | WP_166481397.1 | phage distal tail protein | - |
| HN015_RS03335 (HN015_03350) | - | 685608..687968 (+) | 2361 | WP_166481398.1 | phage tail spike protein | - |
| HN015_RS03340 (HN015_03355) | - | 687970..691263 (+) | 3294 | WP_166481399.1 | hypothetical protein | - |
| HN015_RS03345 (HN015_03360) | - | 691256..691483 (+) | 228 | WP_166481400.1 | hypothetical protein | - |
| HN015_RS03350 (HN015_03365) | - | 691476..691685 (+) | 210 | WP_166481401.1 | hypothetical protein | - |
| HN015_RS03355 (HN015_03370) | - | 691728..691976 (+) | 249 | WP_166481402.1 | hypothetical protein | - |
| HN015_RS03360 (HN015_03375) | - | 691993..692352 (+) | 360 | WP_166481403.1 | hypothetical protein | - |
| HN015_RS03365 (HN015_03380) | - | 692364..693527 (+) | 1164 | WP_166481404.1 | GH25 family lysozyme | - |
| HN015_RS03370 (HN015_03385) | - | 693527..693790 (+) | 264 | WP_138492841.1 | hemolysin XhlA family protein | - |
| HN015_RS03375 (HN015_03390) | - | 693800..694165 (+) | 366 | WP_159215953.1 | phage holin | - |
| HN015_RS03380 (HN015_03395) | map | 694626..695408 (+) | 783 | WP_002830702.1 | type I methionyl aminopeptidase | - |
| HN015_RS03385 (HN015_03400) | - | 696303..697151 (+) | 849 | WP_056985220.1 | ROK family protein | - |
| HN015_RS03390 (HN015_03405) | - | 697132..697863 (+) | 732 | WP_008842377.1 | sugar phosphate isomerase/epimerase family protein | - |
| HN015_RS03395 (HN015_03410) | - | 698116..699624 (+) | 1509 | WP_166481405.1 | sodium:solute symporter | - |
| HN015_RS03400 (HN015_03415) | - | 699639..700556 (+) | 918 | WP_008842374.1 | dihydrodipicolinate synthase family protein | - |
| HN015_RS03405 (HN015_03420) | - | 701326..701661 (+) | 336 | WP_005919288.1 | hypothetical protein | - |
| HN015_RS03410 (HN015_03425) | - | 701821..702039 (+) | 219 | WP_166481406.1 | KxYKxGKxW signal peptide domain-containing protein | - |
| HN015_RS03415 (HN015_03430) | - | 702866..708466 (-) | 5601 | WP_166481407.1 | hypothetical protein | - |
| HN015_RS03420 (HN015_03435) | - | 708610..708819 (+) | 210 | WP_166481408.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15654.36 Da Isoelectric Point: 6.3503
>NTDB_id=444862 HN015_RS03190 WP_166481378.1 663383..663808(+) (ssb) [Pediococcus acidilactici strain PMC65]
MINRTILIGRLTKDVEVRYTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDISDDDLPF
MINRTILIGRLTKDVEVRYTAKGDAVASFTVAVNRQFTNSQGEREADFINCVMWRKAAENFAKYTQKGSLVGIDGRIQTR
SYENQQGQRVYVTEVVADNFSLLDSKPKGNQQNNARQASTPGDPFANGGQSIDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=444862 HN015_RS03190 WP_166481378.1 663383..663808(+) (ssb) [Pediococcus acidilactici strain PMC65]
ATGATTAATCGAACAATACTAATAGGACGTTTAACTAAAGATGTTGAGGTTCGCTACACAGCTAAAGGCGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATTAACTGCGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAATCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCAAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCGGGAGATCCATTCGCCAATGGCGGACAGTCAATTGATA
TTAGTGACGACGATTTACCGTTCTAG
ATGATTAATCGAACAATACTAATAGGACGTTTAACTAAAGATGTTGAGGTTCGCTACACAGCTAAAGGCGATGCGGTAGC
TAGTTTTACCGTGGCAGTTAACCGACAGTTTACCAACTCACAGGGTGAACGTGAAGCGGATTTCATTAACTGCGTAATGT
GGCGGAAAGCGGCGGAAAACTTTGCCAAGTACACACAAAAAGGTTCGTTGGTAGGCATTGACGGTCGAATTCAAACCCGT
TCGTACGAAAATCAACAAGGACAACGAGTTTATGTAACTGAGGTTGTAGCTGATAACTTCTCGTTGCTAGATTCAAAACC
AAAAGGCAACCAGCAAAATAACGCACGGCAAGCATCAACGCCGGGAGATCCATTCGCCAATGGCGGACAGTCAATTGATA
TTAGTGACGACGATTTACCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.412 |
100 |
0.716 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.667 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
62.037 |
76.596 |
0.475 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.254 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.549 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.549 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
38.732 |
100 |
0.39 |