Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HHM65_RS10100 | Genome accession | NZ_CP051624 |
| Coordinates | 2036399..2036815 (+) | Length | 138 a.a. |
| NCBI ID | WP_000609565.1 | Uniprot ID | Q8DXI7 |
| Organism | Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A74 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2014503..2058229 | 2036399..2036815 | within | 0 |
Gene organization within MGE regions
Location: 2014503..2058229
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HHM65_RS09935 (HHM65_09940) | groL | 2014503..2016128 (-) | 1626 | WP_012767614.1 | chaperonin GroEL | - |
| HHM65_RS09940 (HHM65_09945) | groES | 2016164..2016454 (-) | 291 | WP_003054738.1 | co-chaperone GroES | - |
| HHM65_RS09945 (HHM65_09950) | clpC | 2016632..2019076 (-) | 2445 | WP_015058108.1 | ATP-dependent Clp protease ATP-binding subunit | Regulator |
| HHM65_RS09950 (HHM65_09955) | - | 2019076..2019537 (-) | 462 | WP_003054759.1 | CtsR family transcriptional regulator | - |
| HHM65_RS09955 (HHM65_09960) | - | 2019733..2019936 (-) | 204 | WP_003053018.1 | cold-shock protein | - |
| HHM65_RS09960 (HHM65_09965) | - | 2020437..2021321 (+) | 885 | WP_256096233.1 | amidohydrolase family protein | - |
| HHM65_RS09965 (HHM65_09970) | - | 2021366..2022852 (-) | 1487 | Protein_1911 | IS1182 family transposase | - |
| HHM65_RS09970 (HHM65_09975) | - | 2022876..2023136 (-) | 261 | Protein_1912 | DUF4355 domain-containing protein | - |
| HHM65_RS09975 (HHM65_09980) | - | 2023274..2023498 (-) | 225 | WP_015058113.1 | hypothetical protein | - |
| HHM65_RS09980 (HHM65_09985) | - | 2023551..2023970 (-) | 420 | WP_015058114.1 | HD domain-containing protein | - |
| HHM65_RS09985 (HHM65_09990) | - | 2023967..2024173 (-) | 207 | WP_015058115.1 | hypothetical protein | - |
| HHM65_RS09990 (HHM65_09995) | - | 2024175..2025419 (-) | 1245 | WP_015058116.1 | phage head morphogenesis protein | - |
| HHM65_RS09995 (HHM65_10000) | - | 2025420..2025683 (+) | 264 | Protein_1917 | tyrosine-type recombinase/integrase | - |
| HHM65_RS10000 (HHM65_10005) | - | 2025862..2026929 (-) | 1068 | WP_000332283.1 | site-specific integrase | - |
| HHM65_RS10005 (HHM65_10010) | - | 2027053..2027457 (-) | 405 | WP_001879921.1 | DUF4429 domain-containing protein | - |
| HHM65_RS10010 (HHM65_10015) | - | 2027479..2028225 (-) | 747 | WP_000878006.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HHM65_RS10015 (HHM65_10020) | - | 2028234..2028614 (-) | 381 | WP_000466347.1 | helix-turn-helix transcriptional regulator | - |
| HHM65_RS10020 (HHM65_10025) | - | 2028902..2029066 (+) | 165 | WP_000511144.1 | hypothetical protein | - |
| HHM65_RS10025 (HHM65_10030) | - | 2029049..2029519 (-) | 471 | WP_001052629.1 | hypothetical protein | - |
| HHM65_RS10030 (HHM65_10035) | - | 2029580..2029792 (+) | 213 | WP_000082754.1 | helix-turn-helix transcriptional regulator | - |
| HHM65_RS10035 (HHM65_10040) | - | 2029792..2030133 (+) | 342 | WP_001123159.1 | hypothetical protein | - |
| HHM65_RS10040 (HHM65_10045) | - | 2030180..2030710 (+) | 531 | WP_001006993.1 | NUMOD4 domain-containing protein | - |
| HHM65_RS10045 (HHM65_10050) | - | 2030710..2030994 (+) | 285 | WP_000998974.1 | hypothetical protein | - |
| HHM65_RS10050 (HHM65_10055) | - | 2031018..2031236 (+) | 219 | WP_001061695.1 | hypothetical protein | - |
| HHM65_RS10055 (HHM65_10060) | dnaB | 2031245..2032576 (+) | 1332 | WP_000343910.1 | replicative DNA helicase | - |
| HHM65_RS10060 (HHM65_10065) | - | 2032578..2033180 (+) | 603 | WP_000712924.1 | hypothetical protein | - |
| HHM65_RS10065 (HHM65_10070) | - | 2033158..2033904 (+) | 747 | WP_000079055.1 | conserved phage C-terminal domain-containing protein | - |
| HHM65_RS10070 (HHM65_10075) | - | 2033905..2034726 (+) | 822 | WP_001067870.1 | ATP-binding protein | - |
| HHM65_RS10075 (HHM65_10080) | - | 2034726..2034974 (+) | 249 | WP_000120544.1 | hypothetical protein | - |
| HHM65_RS10080 (HHM65_10085) | - | 2034967..2035461 (+) | 495 | WP_000169323.1 | MazG-like family protein | - |
| HHM65_RS10085 (HHM65_10090) | - | 2035458..2035787 (+) | 330 | WP_000794211.1 | DUF1372 family protein | - |
| HHM65_RS11000 | - | 2035787..2035930 (+) | 144 | Protein_1936 | hypothetical protein | - |
| HHM65_RS11005 | - | 2035940..2036206 (+) | 267 | WP_044556605.1 | DUF3310 domain-containing protein | - |
| HHM65_RS10095 (HHM65_10100) | - | 2036203..2036409 (+) | 207 | WP_000748199.1 | hypothetical protein | - |
| HHM65_RS10100 (HHM65_10105) | ssb | 2036399..2036815 (+) | 417 | WP_000609565.1 | single-stranded DNA-binding protein | Machinery gene |
| HHM65_RS10105 (HHM65_10110) | - | 2036825..2037085 (+) | 261 | WP_001008140.1 | hypothetical protein | - |
| HHM65_RS10110 (HHM65_10115) | - | 2037082..2037429 (+) | 348 | WP_000776714.1 | helix-turn-helix transcriptional regulator | - |
| HHM65_RS10115 (HHM65_10120) | - | 2037426..2037890 (+) | 465 | WP_000163169.1 | hypothetical protein | - |
| HHM65_RS10120 (HHM65_10125) | - | 2038000..2038542 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| HHM65_RS10125 (HHM65_10130) | - | 2038832..2039119 (+) | 288 | WP_000651009.1 | hypothetical protein | - |
| HHM65_RS10130 (HHM65_10135) | - | 2039242..2039478 (+) | 237 | WP_223846017.1 | HNH endonuclease | - |
| HHM65_RS10135 (HHM65_10140) | - | 2039566..2040051 (+) | 486 | WP_000601035.1 | hypothetical protein | - |
| HHM65_RS10140 (HHM65_10145) | - | 2040044..2041756 (+) | 1713 | WP_000230004.1 | terminase TerL endonuclease subunit | - |
| HHM65_RS10145 (HHM65_10150) | - | 2041765..2042907 (+) | 1143 | WP_001067328.1 | phage portal protein | - |
| HHM65_RS10150 (HHM65_10155) | - | 2042957..2043499 (+) | 543 | WP_000413200.1 | HK97 family phage prohead protease | - |
| HHM65_RS10155 (HHM65_10160) | - | 2043510..2044772 (+) | 1263 | WP_000749070.1 | phage major capsid protein | - |
| HHM65_RS10160 (HHM65_10165) | - | 2044793..2045128 (+) | 336 | WP_000153862.1 | hypothetical protein | - |
| HHM65_RS10165 (HHM65_10170) | - | 2045125..2045430 (+) | 306 | WP_000842789.1 | head-tail adaptor protein | - |
| HHM65_RS10170 (HHM65_10175) | - | 2045430..2045777 (+) | 348 | WP_001074486.1 | hypothetical protein | - |
| HHM65_RS10175 (HHM65_10180) | - | 2045764..2046108 (+) | 345 | WP_000508738.1 | hypothetical protein | - |
| HHM65_RS10180 (HHM65_10185) | - | 2046123..2046806 (+) | 684 | WP_000222195.1 | hypothetical protein | - |
| HHM65_RS10185 (HHM65_10190) | - | 2046806..2047282 (+) | 477 | WP_000591558.1 | hypothetical protein | - |
| HHM65_RS11080 | - | 2047321..2047449 (+) | 129 | WP_011058372.1 | hypothetical protein | - |
| HHM65_RS10190 (HHM65_10195) | - | 2047468..2050203 (+) | 2736 | WP_000140779.1 | phage tail tape measure protein | - |
| HHM65_RS10195 (HHM65_10200) | - | 2050200..2050922 (+) | 723 | WP_000161557.1 | hypothetical protein | - |
| HHM65_RS10200 (HHM65_10205) | - | 2050923..2054597 (+) | 3675 | WP_001895725.1 | phage tail spike protein | - |
| HHM65_RS10205 (HHM65_10210) | - | 2054614..2054844 (+) | 231 | WP_001071121.1 | hypothetical protein | - |
| HHM65_RS10210 (HHM65_10215) | - | 2054847..2055185 (+) | 339 | WP_000213866.1 | hypothetical protein | - |
| HHM65_RS10215 (HHM65_10220) | - | 2055220..2055630 (+) | 411 | WP_001135353.1 | hypothetical protein | - |
| HHM65_RS10220 (HHM65_10225) | - | 2055633..2055962 (+) | 330 | WP_000192161.1 | phage holin | - |
| HHM65_RS10225 (HHM65_10230) | - | 2055966..2057372 (+) | 1407 | WP_000405192.1 | peptidoglycan amidohydrolase family protein | - |
| HHM65_RS10230 (HHM65_10235) | - | 2057579..2057764 (+) | 186 | WP_000139836.1 | type II toxin-antitoxin system HicA family toxin | - |
| HHM65_RS10235 (HHM65_10240) | - | 2057825..2058229 (+) | 405 | WP_000878126.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15674.52 Da Isoelectric Point: 4.6604
>NTDB_id=439919 HHM65_RS10100 WP_000609565.1 2036399..2036815(+) (ssb) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A74]
MINNVVLIGRLTRDVELRYTPSNIANATFNLAVNRNFKNAAGDREADFINCVMWRQQAENLANWTKKGMLIGITGRIQTR
SYENQQGQRIYVTEVVADSFQILEKRDNSTNQASMDDQLPPSFGNSQPMDISDDDLPF
MINNVVLIGRLTRDVELRYTPSNIANATFNLAVNRNFKNAAGDREADFINCVMWRQQAENLANWTKKGMLIGITGRIQTR
SYENQQGQRIYVTEVVADSFQILEKRDNSTNQASMDDQLPPSFGNSQPMDISDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=439919 HHM65_RS10100 WP_000609565.1 2036399..2036815(+) (ssb) [Streptococcus dysgalactiae subsp. equisimilis strain TPCH-A74]
ATGATCAATAATGTTGTACTTATTGGCCGCTTGACAAGAGATGTTGAGCTACGTTACACGCCGTCAAACATCGCAAACGC
TACTTTTAACCTAGCAGTCAATCGAAATTTCAAGAATGCTGCTGGTGATCGTGAAGCTGATTTCATCAACTGTGTGATGT
GGCGACAACAAGCTGAAAACTTGGCCAATTGGACGAAAAAAGGAATGCTGATTGGTATTACTGGACGAATCCAGACAAGA
AGCTACGAAAATCAGCAAGGTCAGCGTATCTATGTGACTGAGGTTGTTGCTGACAGCTTCCAGATTCTTGAAAAGCGTGA
TAATTCAACGAACCAGGCAAGCATGGATGACCAATTGCCACCATCATTTGGAAATAGTCAGCCTATGGATATTTCAGATG
ATGATCTACCGTTTTAG
ATGATCAATAATGTTGTACTTATTGGCCGCTTGACAAGAGATGTTGAGCTACGTTACACGCCGTCAAACATCGCAAACGC
TACTTTTAACCTAGCAGTCAATCGAAATTTCAAGAATGCTGCTGGTGATCGTGAAGCTGATTTCATCAACTGTGTGATGT
GGCGACAACAAGCTGAAAACTTGGCCAATTGGACGAAAAAAGGAATGCTGATTGGTATTACTGGACGAATCCAGACAAGA
AGCTACGAAAATCAGCAAGGTCAGCGTATCTATGTGACTGAGGTTGTTGCTGACAGCTTCCAGATTCTTGAAAAGCGTGA
TAATTCAACGAACCAGGCAAGCATGGATGACCAATTGCCACCATCATTTGGAAATAGTCAGCCTATGGATATTTCAGATG
ATGATCTACCGTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.575 |
100 |
0.638 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.259 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
76.812 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.559 |
100 |
0.42 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.943 |
76.812 |
0.391 |