Detailed information NTG0434986

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: HED61_RS01635
• Genome accession: NZ_CP050816
• Coordinates: 357945..358220 (-)
• Length: 91 a.a.
• NCBI ID: WP_029487321.1
• Uniprot ID: -
• Organism: Enterococcus gallinarum strain EG81
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 352945..363220

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HED61_RS01595 (HED61_01595)	-	353207..353548 (+)	342	WP_081131433.1	DUF1048 domain-containing protein	-
HED61_RS01600 (HED61_01600)	-	353558..353869 (+)	312	WP_081131434.1	DUF1048 domain-containing protein	-
HED61_RS01605 (HED61_01605)	-	354083..355267 (-)	1185	WP_113850254.1	acetate/propionate family kinase	-
HED61_RS01610 (HED61_01610)	-	355292..356299 (-)	1008	WP_003128442.1	class I SAM-dependent methyltransferase	-
HED61_RS01615 (HED61_01615)	comGG	356474..356779 (-)	306	WP_231455746.1	competence type IV pilus minor pilin ComGG	-
HED61_RS01620 (HED61_01620)	comGF	356802..357215 (-)	414	WP_003128440.1	competence type IV pilus minor pilin ComGF	-
HED61_RS01625 (HED61_01625)	-	357205..357516 (-)	312	WP_228074027.1	hypothetical protein	-
HED61_RS01630 (HED61_01630)	comGD	357497..357976 (-)	480	WP_103300293.1	competence type IV pilus minor pilin ComGD	-
HED61_RS01635 (HED61_01635)	comYC	357945..358220 (-)	276	WP_029487321.1	competence type IV pilus major pilin ComGC	Machinery gene
HED61_RS01640 (HED61_01640)	comGB	358217..359248 (-)	1032	WP_219645416.1	competence type IV pilus assembly protein ComGB	-
HED61_RS01645 (HED61_01645)	comGA	359223..360164 (-)	942	WP_005472888.1	competence type IV pilus ATPase ComGA	-
HED61_RS01650 (HED61_01650)	trmB	360276..360938 (-)	663	WP_138371442.1	tRNA (guanosine(46)-N7)-methyltransferase TrmB	-
HED61_RS01655 (HED61_01655)	-	360992..361771 (-)	780	WP_003128432.1	phosphotransferase family protein	-
HED61_RS01660 (HED61_01660)	-	361876..363087 (-)	1212	WP_219645417.1	ABC transporter permease	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10464.26 Da
• Isoelectric Point: 6.4633

>NTDB_id=434986 HED61_RS01635 WP_029487321.1 357945..358220(-) (comYC) [Enterococcus gallinarum strain EG81]
MRKLKHQGFTLVEMLIVLLVISILILLFVPNLSAQRTVIDEKGNAAIVKVVETQIELFQLNENRTPTRQELLAGNYVTEE
QYAIYLAHRNE

Nucleotide

• Length: 276 bp

>NTDB_id=434986 HED61_RS01635 WP_029487321.1 357945..358220(-) (comYC) [Enterococcus gallinarum strain EG81]
ATGAGAAAATTGAAGCATCAGGGGTTCACATTGGTGGAGATGCTGATTGTACTGTTAGTGATCAGTATTTTGATTTTATT
GTTTGTACCAAACTTATCCGCACAACGTACAGTGATAGATGAGAAAGGAAATGCGGCAATCGTCAAAGTCGTAGAAACCC
AGATTGAGTTGTTCCAGCTTAATGAGAATCGAACACCTACTCGACAAGAATTACTAGCTGGAAATTATGTAACGGAGGAG
CAGTATGCGATTTATCTTGCCCATCGGAACGAATAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	51.613	100	0.527
comGC/cglC	Streptococcus mitis NCTC 12261	50.538	100	0.516
comYC	Streptococcus mutans UA159	48.387	100	0.495
comYC	Streptococcus mutans UA140	48.387	100	0.495
comGC/cglC	Streptococcus pneumoniae TIGR4	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae Rx1	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae D39	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae R6	48.352	100	0.484
comGC/cglC	Streptococcus mitis SK321	51.765	93.407	0.484
comGC	Lactococcus lactis subsp. cremoris KW2	50	96.703	0.484
comYC	Streptococcus gordonii str. Challis substr. CH1	48.315	97.802	0.473
comGC	Staphylococcus aureus MW2	44.872	85.714	0.385
comGC	Staphylococcus aureus N315	44.872	85.714	0.385