Detailed information NTG0433242

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: EGM181_RS01265
• Genome accession: NZ_CP050485
• Coordinates: 218559..218834 (+)
• Length: 91 a.a.
• NCBI ID: WP_029487321.1
• Uniprot ID: -
• Organism: Enterococcus gallinarum strain EGM181
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 213559..223834

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EGM181_RS01240 (EGM181_01250)	-	213692..214903 (+)	1212	WP_113850256.1	ABC transporter permease	-
EGM181_RS01245 (EGM181_01255)	-	215008..215787 (+)	780	WP_003128432.1	phosphotransferase family protein	-
EGM181_RS01250 (EGM181_01260)	trmB	215841..216503 (+)	663	WP_003128433.1	tRNA (guanosine(46)-N7)-methyltransferase TrmB	-
EGM181_RS01255 (EGM181_01265)	comGA	216615..217556 (+)	942	WP_005472888.1	competence type IV pilus ATPase ComGA	-
EGM181_RS01260 (EGM181_01270)	comGB	217531..218562 (+)	1032	WP_113850255.1	competence type IV pilus assembly protein ComGB	-
EGM181_RS01265 (EGM181_01275)	comYC	218559..218834 (+)	276	WP_029487321.1	competence type IV pilus major pilin ComGC	Machinery gene
EGM181_RS01270 (EGM181_01280)	comGD	218803..219282 (+)	480	WP_081131435.1	competence type IV pilus minor pilin ComGD	-
EGM181_RS01275 (EGM181_01285)	-	219263..219574 (+)	312	WP_225585900.1	hypothetical protein	-
EGM181_RS01280 (EGM181_01290)	comGF	219564..219977 (+)	414	WP_003128440.1	competence type IV pilus minor pilin ComGF	-
EGM181_RS18435 (EGM181_01295)	comGG	220027..220305 (+)	279	WP_050801522.1	competence type IV pilus minor pilin ComGG	-
EGM181_RS01290 (EGM181_01300)	-	220480..221487 (+)	1008	WP_003128442.1	class I SAM-dependent methyltransferase	-
EGM181_RS01295 (EGM181_01305)	-	221512..222696 (+)	1185	WP_113850254.1	acetate/propionate family kinase	-
EGM181_RS01300 (EGM181_01310)	-	222910..223221 (-)	312	WP_081131434.1	DUF1048 domain-containing protein	-
EGM181_RS01305 (EGM181_01315)	-	223231..223572 (-)	342	WP_113850253.1	DUF1048 domain-containing protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10464.26 Da
• Isoelectric Point: 6.4633

>NTDB_id=433242 EGM181_RS01265 WP_029487321.1 218559..218834(+) (comYC) [Enterococcus gallinarum strain EGM181]
MRKLKHQGFTLVEMLIVLLVISILILLFVPNLSAQRTVIDEKGNAAIVKVVETQIELFQLNENRTPTRQELLAGNYVTEE
QYAIYLAHRNE

Nucleotide

• Length: 276 bp

>NTDB_id=433242 EGM181_RS01265 WP_029487321.1 218559..218834(+) (comYC) [Enterococcus gallinarum strain EGM181]
ATGAGAAAATTGAAGCATCAAGGGTTCACATTGGTGGAGATGCTGATTGTACTGTTAGTGATCAGTATTTTGATTTTATT
GTTTGTACCAAACTTATCTGCACAACGTACAGTGATAGATGAGAAAGGAAATGCGGCAATCGTCAAAGTCGTAGAAACCC
AGATTGAATTGTTCCAGCTTAATGAGAATCGAACACCTACTCGACAAGAATTACTAGCTGGAAATTATGTAACGGAGGAG
CAGTATGCGATTTATCTTGCCCATCGGAACGAATAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	51.613	100	0.527
comGC/cglC	Streptococcus mitis NCTC 12261	50.538	100	0.516
comYC	Streptococcus mutans UA159	48.387	100	0.495
comYC	Streptococcus mutans UA140	48.387	100	0.495
comGC/cglC	Streptococcus pneumoniae TIGR4	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae Rx1	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae D39	48.352	100	0.484
comGC/cglC	Streptococcus pneumoniae R6	48.352	100	0.484
comGC/cglC	Streptococcus mitis SK321	51.765	93.407	0.484
comGC	Lactococcus lactis subsp. cremoris KW2	50	96.703	0.484
comYC	Streptococcus gordonii str. Challis substr. CH1	48.315	97.802	0.473
comGC	Staphylococcus aureus MW2	44.872	85.714	0.385
comGC	Staphylococcus aureus N315	44.872	85.714	0.385