Detailed information NTG0421291

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: GZ067_RS02330
• Genome accession: NZ_CP048431
• Coordinates: 444797..445108 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain SA1428
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 439797..450108

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GZ067_RS02300 (GZ067_02300)	-	440580..440783 (+)	204	WP_000087561.1	YqgQ family protein	-
GZ067_RS02305 (GZ067_02305)	-	440780..441766 (+)	987	WP_000161314.1	ROK family glucokinase	-
GZ067_RS02310 (GZ067_02310)	-	441766..442095 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
GZ067_RS02315 (GZ067_02315)	-	442092..442715 (+)	624	WP_117223063.1	MBL fold metallo-hydrolase	-
GZ067_RS02320 (GZ067_02320)	comGA	442767..443741 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
GZ067_RS02325 (GZ067_02325)	comGB	443713..444783 (+)	1071	WP_000776421.1	competence type IV pilus assembly protein ComGB	Machinery gene
GZ067_RS02330 (GZ067_02330)	comGC	444797..445108 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
GZ067_RS02335 (GZ067_02335)	comGD	445086..445532 (+)	447	WP_072433556.1	competence type IV pilus minor pilin ComGD	Machinery gene
GZ067_RS02340 (GZ067_02340)	comGE	445519..445818 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
GZ067_RS02345 (GZ067_02345)	comGF	445736..446233 (+)	498	WP_029694050.1	competence type IV pilus minor pilin ComGF	Machinery gene
GZ067_RS02350 (GZ067_02350)	-	446330..446476 (+)	147	WP_001789879.1	hypothetical protein	-
GZ067_RS02355 (GZ067_02355)	-	446466..446990 (+)	525	WP_001015121.1	shikimate kinase	-
GZ067_RS02360 (GZ067_02360)	gcvT	447149..448240 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
GZ067_RS02365 (GZ067_02365)	gcvPA	448260..449606 (+)	1347	WP_000019691.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=421291 GZ067_RS02330 WP_000472256.1 444797..445108(+) (comGC) [Staphylococcus aureus strain SA1428]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=421291 GZ067_RS02330 WP_000472256.1 444797..445108(+) (comGC) [Staphylococcus aureus strain SA1428]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369