Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S64_RS06200 | Genome accession | NZ_CP047861 |
| Coordinates | 1215891..1216319 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain UP_1322 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1175034..1225680 | 1215891..1216319 | within | 0 |
Gene organization within MGE regions
Location: 1175034..1225680
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S64_RS05895 (E3S64_05895) | - | 1175034..1175861 (-) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
| E3S64_RS05900 (E3S64_05900) | - | 1175874..1176722 (-) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| E3S64_RS05905 (E3S64_05905) | - | 1176770..1176853 (-) | 84 | WP_016170465.1 | hypothetical protein | - |
| E3S64_RS05910 (E3S64_05910) | - | 1177064..1178131 (-) | 1068 | WP_000267236.1 | NAD(P)H-dependent flavin oxidoreductase | - |
| E3S64_RS05915 (E3S64_05915) | - | 1178145..1179185 (-) | 1041 | WP_160199665.1 | hemolysin family protein | - |
| E3S64_RS05920 (E3S64_05920) | - | 1179550..1179864 (+) | 315 | WP_000274029.1 | hypothetical protein | - |
| E3S64_RS05925 (E3S64_05925) | - | 1179870..1180009 (-) | 140 | Protein_1141 | hypothetical protein | - |
| E3S64_RS05930 (E3S64_05930) | - | 1180694..1180879 (-) | 186 | WP_001286805.1 | hypothetical protein | - |
| E3S64_RS05935 (E3S64_05935) | - | 1180881..1180991 (-) | 111 | WP_000139423.1 | hypothetical protein | - |
| E3S64_RS05940 (E3S64_05940) | - | 1181062..1181214 (-) | 153 | WP_001788502.1 | hypothetical protein | - |
| E3S64_RS05945 (E3S64_05945) | - | 1181589..1182146 (+) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| E3S64_RS05950 (E3S64_05950) | - | 1182206..1183618 (-) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| E3S64_RS05955 (E3S64_05955) | - | 1183605..1183880 (-) | 276 | WP_000351119.1 | phage holin | - |
| E3S64_RS05960 (E3S64_05960) | - | 1183936..1184331 (-) | 396 | WP_000398868.1 | hypothetical protein | - |
| E3S64_RS05965 (E3S64_05965) | - | 1184337..1185575 (-) | 1239 | WP_160199659.1 | BppU family phage baseplate upper protein | - |
| E3S64_RS05970 (E3S64_05970) | - | 1185588..1187486 (-) | 1899 | WP_000524022.1 | glucosaminidase domain-containing protein | - |
| E3S64_RS05975 (E3S64_05975) | - | 1187623..1187922 (-) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| E3S64_RS05980 (E3S64_05980) | - | 1187962..1188135 (-) | 174 | WP_000782200.1 | XkdX family protein | - |
| E3S64_RS05985 (E3S64_05985) | - | 1188139..1188516 (-) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| E3S64_RS05990 (E3S64_05990) | - | 1188516..1190339 (-) | 1824 | WP_000259619.1 | phage baseplate upper protein | - |
| E3S64_RS05995 (E3S64_05995) | - | 1190339..1192249 (-) | 1911 | WP_000369017.1 | hypothetical protein | - |
| E3S64_RS06000 (E3S64_06000) | - | 1192264..1194165 (-) | 1902 | WP_160199660.1 | SGNH/GDSL hydrolase family protein | - |
| E3S64_RS06005 (E3S64_06005) | - | 1194174..1195121 (-) | 948 | WP_160199661.1 | phage tail family protein | - |
| E3S64_RS06010 (E3S64_06010) | - | 1195134..1198598 (-) | 3465 | WP_103146790.1 | hypothetical protein | - |
| E3S64_RS06015 (E3S64_06015) | - | 1198615..1198959 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| E3S64_RS06020 (E3S64_06020) | - | 1198989..1199354 (-) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| E3S64_RS06025 (E3S64_06025) | - | 1199417..1199998 (-) | 582 | WP_000002578.1 | phage major tail protein, TP901-1 family | - |
| E3S64_RS06030 (E3S64_06030) | - | 1200017..1200400 (-) | 384 | WP_000188643.1 | hypothetical protein | - |
| E3S64_RS06035 (E3S64_06035) | - | 1200412..1200759 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| E3S64_RS06040 (E3S64_06040) | - | 1200759..1201061 (-) | 303 | WP_001268314.1 | hypothetical protein | - |
| E3S64_RS06045 (E3S64_06045) | - | 1201058..1201390 (-) | 333 | WP_000209972.1 | phage head-tail connector protein | - |
| E3S64_RS06050 (E3S64_06050) | - | 1201399..1201686 (-) | 288 | WP_001114086.1 | hypothetical protein | - |
| E3S64_RS06055 (E3S64_06055) | - | 1201708..1202682 (-) | 975 | WP_000438511.1 | phage major capsid protein | - |
| E3S64_RS06060 (E3S64_06060) | - | 1202696..1203316 (-) | 621 | WP_000392151.1 | DUF4355 domain-containing protein | - |
| E3S64_RS14505 | - | 1203310..1203397 (-) | 88 | Protein_1169 | hypothetical protein | - |
| E3S64_RS06065 (E3S64_06065) | - | 1203425..1203595 (-) | 171 | WP_000072208.1 | hypothetical protein | - |
| E3S64_RS06070 (E3S64_06070) | - | 1203668..1204663 (-) | 996 | WP_001133044.1 | minor capsid protein | - |
| E3S64_RS06075 (E3S64_06075) | - | 1204670..1206208 (-) | 1539 | WP_000909970.1 | phage portal protein | - |
| E3S64_RS06080 (E3S64_06080) | - | 1206219..1207514 (-) | 1296 | WP_000273011.1 | PBSX family phage terminase large subunit | - |
| E3S64_RS06085 (E3S64_06085) | - | 1207517..1208011 (-) | 495 | WP_001038244.1 | terminase small subunit | - |
| E3S64_RS06090 (E3S64_06090) | - | 1208199..1208621 (-) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| E3S64_RS06095 (E3S64_06095) | - | 1208690..1208791 (-) | 102 | Protein_1176 | hypothetical protein | - |
| E3S64_RS06100 (E3S64_06100) | rinB | 1208792..1208965 (-) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| E3S64_RS06105 (E3S64_06105) | - | 1208958..1209194 (-) | 237 | WP_000608278.1 | hypothetical protein | - |
| E3S64_RS06110 (E3S64_06110) | - | 1209187..1209390 (-) | 204 | WP_001072795.1 | hypothetical protein | - |
| E3S64_RS06115 (E3S64_06115) | - | 1209387..1209581 (-) | 195 | WP_000132921.1 | hypothetical protein | - |
| E3S64_RS06120 (E3S64_06120) | - | 1209578..1209784 (-) | 207 | WP_000617154.1 | DUF1381 domain-containing protein | - |
| E3S64_RS06125 (E3S64_06125) | - | 1209821..1210354 (-) | 534 | WP_000185647.1 | dUTP diphosphatase | - |
| E3S64_RS06130 (E3S64_06130) | - | 1210347..1210517 (-) | 171 | WP_000714412.1 | hypothetical protein | - |
| E3S64_RS06135 (E3S64_06135) | - | 1210504..1210758 (-) | 255 | WP_001065060.1 | DUF1024 family protein | - |
| E3S64_RS06140 (E3S64_06140) | - | 1210751..1211122 (-) | 372 | WP_001557190.1 | hypothetical protein | - |
| E3S64_RS06145 (E3S64_06145) | - | 1211131..1211373 (-) | 243 | WP_000131376.1 | SAV1978 family virulence-associated passenger protein | - |
| E3S64_RS06150 (E3S64_06150) | - | 1211377..1211733 (-) | 357 | WP_000029376.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S64_RS06155 (E3S64_06155) | - | 1211861..1212166 (-) | 306 | WP_000101252.1 | hypothetical protein | - |
| E3S64_RS06160 (E3S64_06160) | - | 1212167..1212352 (-) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| E3S64_RS06165 (E3S64_06165) | - | 1212357..1212761 (-) | 405 | WP_000049794.1 | DUF1064 domain-containing protein | - |
| E3S64_RS06170 (E3S64_06170) | - | 1212771..1212992 (-) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| E3S64_RS06175 (E3S64_06175) | - | 1213005..1213163 (-) | 159 | WP_000256589.1 | hypothetical protein | - |
| E3S64_RS06180 (E3S64_06180) | - | 1213157..1213936 (-) | 780 | WP_000803062.1 | ATP-binding protein | - |
| E3S64_RS06185 (E3S64_06185) | - | 1213946..1214717 (-) | 772 | Protein_1194 | conserved phage C-terminal domain-containing protein | - |
| E3S64_RS06190 (E3S64_06190) | - | 1214783..1215064 (+) | 282 | WP_000414755.1 | hypothetical protein | - |
| E3S64_RS14445 | - | 1215057..1215206 (-) | 150 | WP_001081076.1 | hypothetical protein | - |
| E3S64_RS06195 (E3S64_06195) | - | 1215203..1215877 (-) | 675 | WP_001124438.1 | putative HNHc nuclease | - |
| E3S64_RS06200 (E3S64_06200) | ssbA | 1215891..1216319 (-) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S64_RS06205 (E3S64_06205) | - | 1216319..1216942 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| E3S64_RS06210 (E3S64_06210) | - | 1216935..1217156 (-) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| E3S64_RS06215 (E3S64_06215) | - | 1217166..1217426 (-) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| E3S64_RS06220 (E3S64_06220) | - | 1217431..1217733 (-) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| E3S64_RS06225 (E3S64_06225) | - | 1217827..1217988 (-) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| E3S64_RS06230 (E3S64_06230) | - | 1217981..1218202 (-) | 222 | WP_000977381.1 | hypothetical protein | - |
| E3S64_RS06235 (E3S64_06235) | - | 1218216..1218665 (-) | 450 | WP_001094943.1 | hypothetical protein | - |
| E3S64_RS06240 (E3S64_06240) | tscA | 1218705..1218929 (-) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| E3S64_RS06245 (E3S64_06245) | - | 1218930..1219697 (-) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| E3S64_RS06250 (E3S64_06250) | - | 1219697..1219891 (-) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| E3S64_RS06255 (E3S64_06255) | - | 1220154..1220486 (+) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| E3S64_RS06260 (E3S64_06260) | - | 1220503..1221177 (+) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| E3S64_RS06265 (E3S64_06265) | - | 1221205..1221930 (+) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| E3S64_RS06270 (E3S64_06270) | - | 1221962..1222894 (+) | 933 | WP_000392186.1 | hypothetical protein | - |
| E3S64_RS06275 (E3S64_06275) | - | 1222874..1223053 (-) | 180 | WP_000337826.1 | hypothetical protein | - |
| E3S64_RS06280 (E3S64_06280) | - | 1223166..1224215 (+) | 1050 | WP_001145726.1 | tyrosine-type recombinase/integrase | - |
| E3S64_RS06285 (E3S64_06285) | sufB | 1224283..1225680 (-) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=418026 E3S64_RS06200 WP_000934385.1 1215891..1216319(-) (ssbA) [Staphylococcus aureus strain UP_1322]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=418026 E3S64_RS06200 WP_000934385.1 1215891..1216319(-) (ssbA) [Staphylococcus aureus strain UP_1322]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |