Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E3S80_RS00605 | Genome accession | NZ_CP047847 |
| Coordinates | 105410..105829 (+) | Length | 139 a.a. |
| NCBI ID | WP_031927925.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain UP_522 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 98606..142739 | 105410..105829 | within | 0 |
Gene organization within MGE regions
Location: 98606..142739
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S80_RS00535 (E3S80_00535) | - | 98606..99652 (-) | 1047 | WP_001145722.1 | tyrosine-type recombinase/integrase | - |
| E3S80_RS00540 (E3S80_00540) | - | 99765..99944 (+) | 180 | WP_000337827.1 | hypothetical protein | - |
| E3S80_RS00545 (E3S80_00545) | - | 99924..100856 (-) | 933 | WP_000392183.1 | hypothetical protein | - |
| E3S80_RS00550 (E3S80_00550) | - | 100996..101163 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| E3S80_RS00555 (E3S80_00555) | - | 101233..101952 (-) | 720 | WP_000358224.1 | XRE family transcriptional regulator | - |
| E3S80_RS00560 (E3S80_00560) | - | 102094..102312 (+) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| E3S80_RS00565 (E3S80_00565) | - | 102328..103107 (+) | 780 | WP_025920887.1 | phage antirepressor | - |
| E3S80_RS00570 (E3S80_00570) | tscA | 103108..103332 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| E3S80_RS00575 (E3S80_00575) | - | 103372..103821 (+) | 450 | WP_001094943.1 | hypothetical protein | - |
| E3S80_RS00580 (E3S80_00580) | - | 103835..104056 (+) | 222 | WP_000977381.1 | hypothetical protein | - |
| E3S80_RS00585 (E3S80_00585) | - | 104049..104210 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| E3S80_RS00590 (E3S80_00590) | - | 104303..104563 (+) | 261 | WP_029625653.1 | DUF1108 family protein | - |
| E3S80_RS00595 (E3S80_00595) | - | 104573..104794 (+) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| E3S80_RS00600 (E3S80_00600) | - | 104787..105410 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| E3S80_RS00605 (E3S80_00605) | ssbA | 105410..105829 (+) | 420 | WP_031927925.1 | single-stranded DNA-binding protein | Machinery gene |
| E3S80_RS00610 (E3S80_00610) | - | 105840..106391 (+) | 552 | WP_031927924.1 | NUMOD4 domain-containing protein | - |
| E3S80_RS00615 (E3S80_00615) | - | 106392..107066 (+) | 675 | WP_160199363.1 | putative HNHc nuclease | - |
| E3S80_RS14105 | - | 107063..107212 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| E3S80_RS00620 (E3S80_00620) | - | 107205..107486 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| E3S80_RS00625 (E3S80_00625) | - | 107551..108282 (+) | 732 | WP_160199364.1 | helix-turn-helix domain-containing protein | - |
| E3S80_RS00630 (E3S80_00630) | - | 108295..109080 (+) | 786 | WP_024273306.1 | ATP-binding protein | - |
| E3S80_RS00635 (E3S80_00635) | - | 109077..109235 (+) | 159 | WP_000628833.1 | hypothetical protein | - |
| E3S80_RS00640 (E3S80_00640) | - | 109248..109469 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| E3S80_RS00645 (E3S80_00645) | - | 109479..109883 (+) | 405 | WP_000049798.1 | DUF1064 domain-containing protein | - |
| E3S80_RS00650 (E3S80_00650) | - | 109888..110073 (+) | 186 | WP_031873777.1 | DUF3113 family protein | - |
| E3S80_RS00655 (E3S80_00655) | - | 110074..110436 (+) | 363 | WP_160199399.1 | SA1788 family PVL leukocidin-associated protein | - |
| E3S80_RS00660 (E3S80_00660) | - | 110437..110685 (+) | 249 | WP_101291451.1 | phi PVL orf 51-like protein | - |
| E3S80_RS00665 (E3S80_00665) | - | 110699..110905 (+) | 207 | WP_000693987.1 | hypothetical protein | - |
| E3S80_RS00670 (E3S80_00670) | - | 110908..111309 (+) | 402 | WP_000695759.1 | hypothetical protein | - |
| E3S80_RS00675 (E3S80_00675) | - | 111306..111653 (+) | 348 | WP_031867166.1 | YopX family protein | - |
| E3S80_RS00680 (E3S80_00680) | - | 111650..111958 (+) | 309 | WP_072529179.1 | hypothetical protein | - |
| E3S80_RS00685 (E3S80_00685) | - | 111951..112199 (+) | 249 | WP_160199365.1 | DUF1024 family protein | - |
| E3S80_RS00690 (E3S80_00690) | - | 112192..112719 (+) | 528 | WP_031927912.1 | dUTP diphosphatase | - |
| E3S80_RS00695 (E3S80_00695) | - | 112756..112992 (+) | 237 | WP_000195831.1 | DUF1381 domain-containing protein | - |
| E3S80_RS00700 (E3S80_00700) | - | 113017..113253 (+) | 237 | WP_031769004.1 | hypothetical protein | - |
| E3S80_RS00705 (E3S80_00705) | rinB | 113246..113419 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| E3S80_RS00710 (E3S80_00710) | - | 113420..113782 (+) | 363 | WP_000383791.1 | hypothetical protein | - |
| E3S80_RS00715 (E3S80_00715) | - | 113783..113929 (+) | 147 | WP_000989961.1 | hypothetical protein | - |
| E3S80_RS00720 (E3S80_00720) | - | 113944..114363 (+) | 420 | WP_000058634.1 | transcriptional regulator | - |
| E3S80_RS00725 (E3S80_00725) | - | 114550..114990 (+) | 441 | WP_001003272.1 | terminase small subunit | - |
| E3S80_RS00730 (E3S80_00730) | - | 114977..116254 (+) | 1278 | WP_031769002.1 | PBSX family phage terminase large subunit | - |
| E3S80_RS00735 (E3S80_00735) | - | 116265..117800 (+) | 1536 | WP_031769000.1 | phage portal protein | - |
| E3S80_RS00740 (E3S80_00740) | - | 117807..118802 (+) | 996 | WP_001556698.1 | minor capsid protein | - |
| E3S80_RS00745 (E3S80_00745) | - | 118875..119045 (+) | 171 | WP_000072207.1 | hypothetical protein | - |
| E3S80_RS00750 (E3S80_00750) | - | 119180..119794 (+) | 615 | WP_000354309.1 | DUF4355 domain-containing protein | - |
| E3S80_RS00755 (E3S80_00755) | - | 119808..120782 (+) | 975 | WP_031768999.1 | phage major capsid protein | - |
| E3S80_RS00760 (E3S80_00760) | - | 120804..121091 (+) | 288 | WP_001114085.1 | hypothetical protein | - |
| E3S80_RS00765 (E3S80_00765) | - | 121100..121432 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| E3S80_RS00770 (E3S80_00770) | - | 121429..121731 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| E3S80_RS00775 (E3S80_00775) | - | 121731..122078 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| E3S80_RS00780 (E3S80_00780) | - | 122090..122473 (+) | 384 | WP_000188649.1 | hypothetical protein | - |
| E3S80_RS00785 (E3S80_00785) | - | 122492..123073 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| E3S80_RS00790 (E3S80_00790) | - | 123135..123500 (+) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| E3S80_RS00795 (E3S80_00795) | - | 123530..123874 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| E3S80_RS00800 (E3S80_00800) | - | 123891..127358 (+) | 3468 | WP_031862957.1 | membrane protein | - |
| E3S80_RS00805 (E3S80_00805) | - | 127371..128318 (+) | 948 | WP_000350683.1 | phage tail family protein | - |
| E3S80_RS00810 (E3S80_00810) | - | 128327..130228 (+) | 1902 | WP_031768995.1 | SGNH/GDSL hydrolase family protein | - |
| E3S80_RS00815 (E3S80_00815) | - | 130243..132153 (+) | 1911 | WP_031768993.1 | hypothetical protein | - |
| E3S80_RS00820 (E3S80_00820) | - | 132153..133976 (+) | 1824 | WP_031768991.1 | phage baseplate upper protein | - |
| E3S80_RS00825 (E3S80_00825) | - | 133976..134353 (+) | 378 | WP_000705919.1 | DUF2977 domain-containing protein | - |
| E3S80_RS00830 (E3S80_00830) | - | 134363..134536 (+) | 174 | WP_072492067.1 | XkdX family protein | - |
| E3S80_RS00835 (E3S80_00835) | - | 134577..134876 (+) | 300 | WP_000466785.1 | DUF2951 family protein | - |
| E3S80_RS00840 (E3S80_00840) | - | 135013..136911 (+) | 1899 | WP_029549410.1 | N-acetylglucosaminidase | - |
| E3S80_RS00845 (E3S80_00845) | - | 136924..138096 (+) | 1173 | WP_160199366.1 | BppU family phage baseplate upper protein | - |
| E3S80_RS00850 (E3S80_00850) | - | 138102..138497 (+) | 396 | WP_000398878.1 | hypothetical protein | - |
| E3S80_RS00855 (E3S80_00855) | - | 138553..138990 (+) | 438 | WP_031910540.1 | phage holin | - |
| E3S80_RS00860 (E3S80_00860) | - | 138971..140416 (+) | 1446 | WP_031910539.1 | SH3 domain-containing protein | - |
| E3S80_RS00865 (E3S80_00865) | - | 140659..140811 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| E3S80_RS00870 (E3S80_00870) | - | 140882..140992 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| E3S80_RS00875 (E3S80_00875) | - | 140994..141179 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| E3S80_RS00880 (E3S80_00880) | - | 141505..141585 (-) | 81 | WP_100250272.1 | hypothetical protein | - |
| E3S80_RS00885 (E3S80_00885) | - | 141932..142093 (+) | 162 | WP_001005407.1 | SE1561 family protein | - |
| E3S80_RS00890 (E3S80_00890) | - | 142224..142739 (+) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15481.11 Da Isoelectric Point: 6.3642
>NTDB_id=417705 E3S80_RS00605 WP_031927925.1 105410..105829(+) (ssbA) [Staphylococcus aureus strain UP_522]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQNNQQYNGQTQTSNNPFDNNADSIEDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQNNQQYNGQTQTSNNPFDNNADSIEDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=417705 E3S80_RS00605 WP_031927925.1 105410..105829(+) (ssbA) [Staphylococcus aureus strain UP_522]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCAGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAGAATAATCAACAATACAACGGACAAACACAAACTAGTAATAATCCTTTTGATAACAACGCAGACTCTA
TAGAGGATCTTCCTTTTTAG
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCAGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAGAATAATCAACAATACAACGGACAAACACAAACTAGTAATAATCCTTTTGATAACAACGCAGACTCTA
TAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
75.214 |
84.173 |
0.633 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.626 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
76.259 |
0.446 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.446 |
100 |
0.424 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.424 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.417 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.417 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.41 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.41 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.41 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.41 |