Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | E3S73_RS02705 | Genome accession | NZ_CP047799 |
| Coordinates | 487879..488190 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472257.1 | Uniprot ID | A0A115HMG3 |
| Organism | Staphylococcus aureus strain UP_322 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 482879..493190
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S73_RS02670 (E3S73_02670) | - | 483661..483864 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| E3S73_RS02675 (E3S73_02675) | - | 483861..484847 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| E3S73_RS02680 (E3S73_02680) | - | 484847..485176 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| E3S73_RS02685 (E3S73_02685) | - | 485173..485796 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| E3S73_RS02690 (E3S73_02690) | comGA | 485848..486822 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| E3S73_RS13995 | comGB | 486794..487886 (+) | 1093 | Protein_504 | competence type IV pilus assembly protein ComGB | - |
| E3S73_RS02705 (E3S73_02705) | comGC | 487879..488190 (+) | 312 | WP_000472257.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| E3S73_RS02710 (E3S73_02710) | comGD | 488168..488614 (+) | 447 | WP_001791207.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| E3S73_RS02715 (E3S73_02715) | comGE | 488601..488900 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| E3S73_RS02720 (E3S73_02720) | comGF | 488818..489315 (+) | 498 | WP_001794328.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| E3S73_RS02725 (E3S73_02725) | - | 489412..489558 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| E3S73_RS02730 (E3S73_02730) | - | 489548..490072 (+) | 525 | WP_001015125.1 | shikimate kinase | - |
| E3S73_RS02735 (E3S73_02735) | gcvT | 490231..491322 (+) | 1092 | WP_123089974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| E3S73_RS02740 (E3S73_02740) | gcvPA | 491342..492688 (+) | 1347 | WP_000019697.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11373.39 Da Isoelectric Point: 7.8600
>NTDB_id=416667 E3S73_RS02705 WP_000472257.1 487879..488190(+) (comGC) [Staphylococcus aureus strain UP_322]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=416667 E3S73_RS02705 WP_000472257.1 487879..488190(+) (comGC) [Staphylococcus aureus strain UP_322]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
48.039 |
99.029 |
0.476 |
| comGC/cglC | Streptococcus pneumoniae R6 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae D39 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
52.326 |
83.495 |
0.437 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comYC | Streptococcus mutans UA140 |
50 |
73.786 |
0.369 |
| comYC | Streptococcus mutans UA159 |
50 |
73.786 |
0.369 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |