Detailed information NTG0041666

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: PPS_RS03240
• Genome accession: NC_015733
• Coordinates: 718863..719273 (+)
• Length: 136 a.a.
• NCBI ID: WP_013970772.1
• Uniprot ID: -
• Organism: Pseudomonas putida S16
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	719582..739623	718863..719273	flank	309

Gene organization within MGE regions

Location: 718863..739623

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PPS_RS03240 (PPS_0627)	pilA	718863..719273 (+)	411	WP_013970772.1	pilin	Machinery gene
PPS_RS03250 (PPS_0628)	-	719582..720877 (+)	1296	WP_013970773.1	integrase arm-type DNA-binding domain-containing protein	-
PPS_RS03255 (PPS_0629)	-	721128..722123 (+)	996	WP_013970774.1	hypothetical protein	-
PPS_RS03260 (PPS_0630)	-	722176..722439 (+)	264	WP_033701417.1	AlpA family phage regulatory protein	-
PPS_RS03265 (PPS_0631)	-	722436..723029 (+)	594	WP_013970776.1	hypothetical protein	-
PPS_RS03270 (PPS_0633)	-	723582..723863 (+)	282	WP_044046885.1	hypothetical protein	-
PPS_RS03275 (PPS_0634)	-	723860..724144 (+)	285	WP_013970779.1	DUF3077 domain-containing protein	-
PPS_RS03280	-	724141..724762 (+)	622	Protein_634	DNA/RNA helicase, superfamily II protein	-
PPS_RS03285 (PPS_0635)	istB	724918..725718 (-)	801	WP_013970780.1	IS21-like element helper ATPase IstB	-
PPS_RS03290 (PPS_0637)	istA	725711..727210 (-)	1500	Protein_636	IS21 family transposase	-
PPS_RS03295 (PPS_0638)	-	727554..728432 (+)	879	WP_013970781.1	hypothetical protein	-
PPS_RS03300 (PPS_0639)	-	728537..735040 (-)	6504	WP_238531257.1	NACHT domain-containing protein	-
PPS_RS27225	-	735767..736579 (+)	813	WP_049798427.1	DUF2971 domain-containing protein	-
PPS_RS27445 (PPS_0641)	-	737108..737551 (+)	444	WP_080563731.1	GFA family protein	-
PPS_RS03315 (PPS_0643)	-	737677..738827 (+)	1151	WP_085982912.1	IS3 family transposase	-
PPS_RS03320 (PPS_0644)	-	739396..739623 (+)	228	WP_044047208.1	hypothetical protein	-

Sequence

Protein

• Length: 136 a.a.
• Molecular weight: 13769.02 Da
• Isoelectric Point: 7.0812

>NTDB_id=41666 PPS_RS03240 WP_013970772.1 718863..719273(+) (pilA) [Pseudomonas putida S16]
MKGQRGITLIELMIVVAIIGILATIALPMYTNHQSRSKAAAGLLEISALKTAMDLRLNDGKDVPDVAALGGQPATAHCAI
TASGKAADGTGSIVCTLVDAPANALGKALTLTRSASGWGCTTDIEEDLAPKGCKAP

Nucleotide

• Length: 411 bp

>NTDB_id=41666 PPS_RS03240 WP_013970772.1 718863..719273(+) (pilA) [Pseudomonas putida S16]
ATGAAAGGGCAACGCGGTATCACCCTGATCGAACTGATGATCGTCGTCGCGATCATCGGCATTCTGGCGACCATCGCCTT
ACCGATGTACACCAACCACCAGTCACGCTCCAAGGCCGCGGCCGGGTTGCTGGAGATCAGCGCGCTGAAGACCGCGATGG
ACCTGCGGTTGAATGATGGGAAGGATGTGCCGGATGTGGCCGCGCTGGGTGGCCAGCCGGCGACGGCGCACTGTGCGATC
ACGGCTAGCGGCAAGGCGGCGGATGGCACTGGGAGCATCGTTTGCACGCTGGTGGATGCGCCGGCCAATGCGCTGGGCAA
GGCATTGACCCTGACGCGTTCGGCTAGCGGGTGGGGGTGCACGACCGACATTGAAGAAGACCTGGCGCCGAAGGGGTGCA
AGGCGCCTTGA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-134)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Pseudomonas aeruginosa PAK	43.137	100	0.485
pilA	Acinetobacter baumannii strain A118	44.604	100	0.456
pilA/pilA1	Eikenella corrodens VA1	37.58	100	0.434
comP	Acinetobacter baylyi ADP1	39.456	100	0.426
pilA/pilAII	Pseudomonas stutzeri DSM 10701	42.963	99.265	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	42.647	100	0.426
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.063	100	0.39
pilA	Vibrio cholerae strain A1552	37.063	100	0.39
pilA	Vibrio cholerae C6706	37.063	100	0.39
pilA	Vibrio parahaemolyticus RIMD 2210633	38.462	95.588	0.368