Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | SOR_RS09690 | Genome accession | NC_015291 |
| Coordinates | 1955394..1955519 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799678.1 | Uniprot ID | - |
| Organism | Streptococcus oralis Uo5 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1950394..1960519
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SOR_RS09665 (SOR_1981) | - | 1952526..1953068 (+) | 543 | WP_000665079.1 | TetR/AcrR family transcriptional regulator | - |
| SOR_RS09680 (SOR_1984) | comE | 1953311..1954057 (-) | 747 | WP_000866078.1 | competence system response regulator transcription factor ComE | Regulator |
| SOR_RS09685 (SOR_1985) | comD | 1954054..1955373 (-) | 1320 | WP_000362884.1 | competence system sensor histidine kinase ComD | Regulator |
| SOR_RS09690 (SOR_1986) | comC/comC2 | 1955394..1955519 (-) | 126 | WP_000799678.1 | competence-stimulating peptide ComC | Regulator |
| SOR_RS09700 (SOR_1989) | rlmH | 1955801..1956280 (-) | 480 | WP_000694219.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| SOR_RS09705 (SOR_1990) | htrA | 1956466..1957662 (+) | 1197 | WP_000681803.1 | S1C family serine protease | Regulator |
| SOR_RS09710 (SOR_1991) | spo0J | 1957720..1958478 (+) | 759 | WP_000410359.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4960.73 Da Isoelectric Point: 10.3052
>NTDB_id=40231 SOR_RS09690 WP_000799678.1 1955394..1955519(-) (comC/comC2) [Streptococcus oralis Uo5]
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=40231 SOR_RS09690 WP_000799678.1 1955394..1955519(-) (comC/comC2) [Streptococcus oralis Uo5]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAAGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAAGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
56.098 |
100 |
0.561 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |