Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SGGB_RS00640 | Genome accession | NC_017576 |
| Coordinates | 101105..101398 (+) | Length | 97 a.a. |
| NCBI ID | WP_009853231.1 | Uniprot ID | - |
| Organism | Streptococcus gallolyticus subsp. gallolyticus ATCC 43143 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 96105..106398
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGGB_RS00625 (SGGB_0086) | - | 98758..99126 (+) | 369 | WP_009853228.1 | DUF1033 family protein | - |
| SGGB_RS00630 (SGGB_0087) | comGA | 99197..100138 (+) | 942 | WP_012961327.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SGGB_RS00635 (SGGB_0088) | comGB | 100020..101105 (+) | 1086 | WP_012961328.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SGGB_RS00640 (SGGB_0089) | comGC | 101105..101398 (+) | 294 | WP_009853231.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SGGB_RS00645 (SGGB_0090) | comGD | 101382..101813 (+) | 432 | WP_009853232.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SGGB_RS00650 (SGGB_0091) | comGE | 101767..102060 (+) | 294 | WP_012961329.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SGGB_RS00655 (SGGB_0092) | comGF | 102014..102481 (+) | 468 | WP_014619875.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SGGB_RS00660 (SGGB_0093) | comGG | 102453..102767 (+) | 315 | WP_009853235.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SGGB_RS00665 (SGGB_0094) | comGH | 102840..103796 (+) | 957 | WP_009853236.1 | class I SAM-dependent methyltransferase | Machinery gene |
| SGGB_RS00670 (SGGB_0095) | - | 103849..105048 (+) | 1200 | WP_009853237.1 | acetate kinase | - |
| SGGB_RS00675 (SGGB_0096) | - | 105279..105479 (+) | 201 | WP_012961332.1 | helix-turn-helix transcriptional regulator | - |
| SGGB_RS00680 (SGGB_0097) | - | 105489..105698 (+) | 210 | WP_009853239.1 | hypothetical protein | - |
| SGGB_RS00685 (SGGB_0098) | - | 105711..106163 (+) | 453 | WP_009853240.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 97 a.a. Molecular weight: 11042.18 Da Isoelectric Point: 9.9310
>NTDB_id=39506 SGGB_RS00640 WP_009853231.1 101105..101398(+) (comGC) [Streptococcus gallolyticus subsp. gallolyticus ATCC 43143]
MKKIWKKLRQKTVKGFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYEVKTGDKPTVDDLVE
VGYITSEQAKTYNEAKK
MKKIWKKLRQKTVKGFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYEVKTGDKPTVDDLVE
VGYITSEQAKTYNEAKK
Nucleotide
Download Length: 294 bp
>NTDB_id=39506 SGGB_RS00640 WP_009853231.1 101105..101398(+) (comGC) [Streptococcus gallolyticus subsp. gallolyticus ATCC 43143]
ATGAAAAAGATTTGGAAAAAATTACGTCAGAAAACGGTAAAAGGGTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT
TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGACGTTGTTCGTGAAAAAGGCGATGCTGCTG
TTGTGAAAGTGGTAGAGAGCCAAATGGATTTGTACGAAGTGAAAACGGGAGATAAACCAACTGTTGATGATTTAGTTGAA
GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA
ATGAAAAAGATTTGGAAAAAATTACGTCAGAAAACGGTAAAAGGGTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT
TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGACGTTGTTCGTGAAAAAGGCGATGCTGCTG
TTGTGAAAGTGGTAGAGAGCCAAATGGATTTGTACGAAGTGAAAACGGGAGATAAACCAACTGTTGATGATTTAGTTGAA
GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Streptococcus suis isolate S10 |
67.391 |
94.845 |
0.639 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
64.773 |
90.722 |
0.588 |
| comGC/cglC | Streptococcus mitis SK321 |
60.638 |
96.907 |
0.588 |
| comGC/cglC | Streptococcus pneumoniae R6 |
59.574 |
96.907 |
0.577 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
59.574 |
96.907 |
0.577 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
59.574 |
96.907 |
0.577 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
59.574 |
96.907 |
0.577 |
| comGC/cglC | Streptococcus pneumoniae D39 |
59.574 |
96.907 |
0.577 |
| comGC | Streptococcus mutans UA140 |
58.427 |
91.753 |
0.536 |
| comGC | Streptococcus mutans UA159 |
58.427 |
91.753 |
0.536 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
56.667 |
92.784 |
0.526 |