Detailed information NTG0393657

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: FIU98_RS25085
• Genome accession: NZ_CP045359
• Coordinates: 880368..880781 (+)
• Length: 137 a.a.
• NCBI ID: WP_152487867.1
• Uniprot ID: -
• Organism: Pseudomonas sp. THAF42
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	880885..893747	880368..880781	flank	104

Gene organization within MGE regions

Location: 880368..893747

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FIU98_RS25085 (FIU98_03980)	pilA	880368..880781 (+)	414	WP_152487867.1	pilin	Machinery gene
FIU98_RS04035 (FIU98_03985)	pilA	880885..881301 (+)	417	WP_152487868.1	pilin	Machinery gene
FIU98_RS04040 (FIU98_03990)	-	881318..883228 (+)	1911	WP_152487869.1	hypothetical protein	-
FIU98_RS04045 (FIU98_03995)	-	883228..884082 (+)	855	WP_152487870.1	glycosyltransferase family 2 protein	-
FIU98_RS04050 (FIU98_04000)	-	884204..885106 (+)	903	WP_152487871.1	glycosyltransferase	-
FIU98_RS04055 (FIU98_04005)	-	885163..886380 (+)	1218	WP_152487872.1	lipopolysaccharide biosynthesis protein	-
FIU98_RS25165	-	886760..887416 (+)	657	WP_371923266.1	class I SAM-dependent methyltransferase	-
FIU98_RS04065 (FIU98_04015)	-	887676..888413 (+)	738	WP_172979125.1	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	-
FIU98_RS04070 (FIU98_04020)	-	888410..889273 (+)	864	WP_152487875.1	glycosyltransferase family 2 protein	-
FIU98_RS04075 (FIU98_04025)	-	889270..890385 (-)	1116	WP_152487876.1	glycosyltransferase family 4 protein	-
FIU98_RS04080 (FIU98_04030)	-	890436..892364 (-)	1929	WP_152487877.1	acyltransferase family protein	-
FIU98_RS04085 (FIU98_04035)	-	892437..893747 (-)	1311	WP_152487878.1	nucleotide sugar dehydrogenase	-

Sequence

Protein

• Length: 137 a.a.
• Molecular weight: 14219.41 Da
• Isoelectric Point: 7.5897

>NTDB_id=393657 FIU98_RS25085 WP_152487867.1 880368..880781(+) (pilA) [Pseudomonas sp. THAF42]
MKAQMQKGFTLIELMIVVAIIGILAAIALPAYQDYVAKSQVTAGLADIRGGVTAFEEIIQSGASRPANAADIGLQASTAR
CTISITATAGSEEISCALKGNPKVATKTVDLVRNSSGAWNCVVDTTIDSKYRPVGCN

Nucleotide

• Length: 414 bp

>NTDB_id=393657 FIU98_RS25085 WP_152487867.1 880368..880781(+) (pilA) [Pseudomonas sp. THAF42]
ATGAAAGCTCAAATGCAAAAGGGTTTCACCCTGATCGAACTGATGATCGTCGTTGCGATCATCGGTATCCTGGCTGCCAT
CGCGCTGCCGGCCTACCAGGATTACGTTGCCAAGTCGCAGGTGACTGCTGGTCTGGCTGATATTCGTGGCGGTGTGACTG
CTTTTGAAGAAATTATTCAGTCCGGCGCTTCGCGTCCAGCCAATGCTGCAGATATTGGTCTGCAGGCTAGCACTGCTCGT
TGCACTATCTCTATCACCGCTACCGCCGGCTCTGAAGAGATCTCTTGTGCACTGAAAGGTAACCCAAAAGTCGCAACCAA
GACTGTTGATCTTGTGCGTAATAGCTCCGGTGCTTGGAACTGCGTAGTTGACACTACTATTGATAGCAAATATCGCCCGG
TTGGCTGCAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-29)

• Pilin (bacterial filament) (Pilin) (37-137)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Acinetobacter baumannii strain A118	52.941	99.27	0.526
pilA/pilAI	Pseudomonas stutzeri DSM 10701	50	100	0.518
pilA	Pseudomonas aeruginosa PAK	39.752	100	0.467
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	41.611	100	0.453
pilA	Vibrio cholerae strain A1552	41.611	100	0.453
pilA	Vibrio cholerae C6706	41.611	100	0.453
pilA/pilAII	Pseudomonas stutzeri DSM 10701	45.588	99.27	0.453
comP	Acinetobacter baylyi ADP1	41.379	100	0.438
pilA2	Legionella pneumophila str. Paris	42.222	98.54	0.416
pilA2	Legionella pneumophila strain ERS1305867	41.481	98.54	0.409