Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | TMAR_RS11810 | Genome accession | NC_014831 |
| Coordinates | 2825652..2826071 (-) | Length | 139 a.a. |
| NCBI ID | WP_013496726.1 | Uniprot ID | - |
| Organism | Thermaerobacter marianensis DSM 12885 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2816505..2844643 | 2825652..2826071 | within | 0 |
Gene organization within MGE regions
Location: 2816505..2844643
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TMAR_RS11760 (Tmar_2346) | - | 2816505..2817560 (-) | 1056 | WP_013496718.1 | hypothetical protein | - |
| TMAR_RS11765 (Tmar_2347) | - | 2817831..2819240 (-) | 1410 | WP_013496719.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| TMAR_RS11775 (Tmar_2348) | - | 2819766..2821115 (-) | 1350 | WP_013496720.1 | hypothetical protein | - |
| TMAR_RS11785 (Tmar_2349) | - | 2821750..2823057 (-) | 1308 | WP_013496721.1 | adenylosuccinate synthase | - |
| TMAR_RS11790 (Tmar_2350) | dnaB | 2823073..2824404 (-) | 1332 | WP_013496722.1 | replicative DNA helicase | - |
| TMAR_RS11795 (Tmar_2351) | rplI | 2824409..2824858 (-) | 450 | WP_013496723.1 | 50S ribosomal protein L9 | - |
| TMAR_RS11800 (Tmar_2352) | - | 2824891..2825223 (-) | 333 | WP_013496724.1 | MazG-like family protein | - |
| TMAR_RS11805 (Tmar_2353) | rpsR | 2825407..2825634 (-) | 228 | WP_013496725.1 | 30S ribosomal protein S18 | - |
| TMAR_RS11810 (Tmar_2354) | ssb | 2825652..2826071 (-) | 420 | WP_013496726.1 | single-stranded DNA-binding protein | Machinery gene |
| TMAR_RS11815 (Tmar_2355) | rpsF | 2826245..2826538 (-) | 294 | WP_013496727.1 | 30S ribosomal protein S6 | - |
| TMAR_RS11820 (Tmar_2356) | - | 2827042..2827284 (-) | 243 | WP_013496728.1 | DUF951 domain-containing protein | - |
| TMAR_RS13790 (Tmar_2357) | - | 2827281..2828033 (-) | 753 | WP_013496729.1 | CvpA family protein | - |
| TMAR_RS11830 (Tmar_2358) | - | 2828074..2828784 (-) | 711 | WP_013496730.1 | ABC transporter ATP-binding protein | - |
| TMAR_RS11835 (Tmar_2359) | - | 2828784..2829554 (-) | 771 | WP_148235952.1 | ABC transporter ATP-binding protein | - |
| TMAR_RS11840 (Tmar_2360) | - | 2829632..2830717 (-) | 1086 | WP_013496732.1 | branched-chain amino acid ABC transporter permease | - |
| TMAR_RS11845 (Tmar_2361) | - | 2830965..2831870 (-) | 906 | WP_013496733.1 | branched-chain amino acid ABC transporter permease | - |
| TMAR_RS11850 (Tmar_2362) | - | 2832198..2833403 (-) | 1206 | WP_013496734.1 | ABC transporter substrate-binding protein | - |
| TMAR_RS14530 (Tmar_2363) | yyaC | 2833888..2834877 (+) | 990 | WP_013496735.1 | spore protease YyaC | - |
| TMAR_RS11860 (Tmar_2364) | - | 2834978..2836039 (-) | 1062 | WP_013496736.1 | diacylglycerol kinase family protein | - |
| TMAR_RS11865 (Tmar_2365) | - | 2836225..2836827 (-) | 603 | WP_013496737.1 | DUF4446 family protein | - |
| TMAR_RS11870 (Tmar_2366) | - | 2836914..2837804 (-) | 891 | WP_013496738.1 | ParB/RepB/Spo0J family partition protein | - |
| TMAR_RS11875 (Tmar_2367) | - | 2837776..2838558 (-) | 783 | WP_013496739.1 | AAA family ATPase | - |
| TMAR_RS14815 (Tmar_2368) | - | 2838693..2839637 (-) | 945 | WP_013496740.1 | ParB/RepB/Spo0J family partition protein | - |
| TMAR_RS11885 (Tmar_2369) | rsmG | 2839768..2840520 (-) | 753 | WP_013496741.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| TMAR_RS11890 (Tmar_2370) | jag | 2840618..2841313 (-) | 696 | WP_013496742.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| TMAR_RS11895 (Tmar_2371) | - | 2841294..2841968 (-) | 675 | WP_013496743.1 | YidC/Oxa1 family membrane protein insertase | - |
| TMAR_RS11900 (Tmar_2372) | yidD | 2842307..2842516 (-) | 210 | WP_042502310.1 | membrane protein insertion efficiency factor YidD | - |
| TMAR_RS11905 (Tmar_2373) | rnpA | 2842513..2843088 (-) | 576 | WP_013496745.1 | ribonuclease P protein component | - |
| TMAR_RS11910 (Tmar_2374) | rpmH | 2843104..2843238 (-) | 135 | WP_013496746.1 | 50S ribosomal protein L34 | - |
| TMAR_RS11915 (Tmar_2375) | - | 2843489..2844643 (+) | 1155 | WP_013495303.1 | DDE-type integrase/transposase/recombinase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15161.05 Da Isoelectric Point: 4.7796
>NTDB_id=39274 TMAR_RS11810 WP_013496726.1 2825652..2826071(-) (ssb) [Thermaerobacter marianensis DSM 12885]
MLNVVVLIGRLVRDPELRYTPSGVAVGGFTLAVDRPFTNQQGEREADFIDIVVWRKLAETCANHLSKGRLVAVRGRLQVR
SYETQDGQRRRVAEVVADDVRFLDRGPGADRGAAPGSPAGDELADFGDVTGLPDDDIPF
MLNVVVLIGRLVRDPELRYTPSGVAVGGFTLAVDRPFTNQQGEREADFIDIVVWRKLAETCANHLSKGRLVAVRGRLQVR
SYETQDGQRRRVAEVVADDVRFLDRGPGADRGAAPGSPAGDELADFGDVTGLPDDDIPF
Nucleotide
Download Length: 420 bp
>NTDB_id=39274 TMAR_RS11810 WP_013496726.1 2825652..2826071(-) (ssb) [Thermaerobacter marianensis DSM 12885]
GTGCTGAACGTCGTCGTTCTGATCGGCCGGCTGGTGCGCGATCCCGAGTTGCGCTACACGCCCAGCGGCGTGGCCGTCGG
CGGGTTTACCCTGGCGGTGGACCGGCCCTTCACCAACCAGCAGGGCGAACGCGAGGCCGACTTCATCGACATCGTCGTTT
GGCGGAAGCTGGCCGAGACCTGCGCCAACCACCTCAGCAAGGGACGGCTGGTGGCGGTGCGCGGCCGGTTGCAGGTCCGC
TCCTACGAGACCCAGGACGGCCAGCGCCGGCGCGTGGCCGAGGTGGTGGCCGACGACGTGCGGTTCCTCGACCGCGGTCC
CGGCGCGGATCGCGGCGCGGCGCCGGGTAGCCCGGCCGGCGACGAGCTGGCGGACTTCGGTGACGTGACAGGCCTGCCGG
ACGACGACATCCCGTTCTGA
GTGCTGAACGTCGTCGTTCTGATCGGCCGGCTGGTGCGCGATCCCGAGTTGCGCTACACGCCCAGCGGCGTGGCCGTCGG
CGGGTTTACCCTGGCGGTGGACCGGCCCTTCACCAACCAGCAGGGCGAACGCGAGGCCGACTTCATCGACATCGTCGTTT
GGCGGAAGCTGGCCGAGACCTGCGCCAACCACCTCAGCAAGGGACGGCTGGTGGCGGTGCGCGGCCGGTTGCAGGTCCGC
TCCTACGAGACCCAGGACGGCCAGCGCCGGCGCGTGGCCGAGGTGGTGGCCGACGACGTGCGGTTCCTCGACCGCGGTCC
CGGCGCGGATCGCGGCGCGGCGCCGGGTAGCCCGGCCGGCGACGAGCTGGCGGACTTCGGTGACGTGACAGGCCTGCCGG
ACGACGACATCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
45.294 |
100 |
0.554 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.385 |
74.82 |
0.489 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.727 |
100 |
0.417 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.271 |
76.978 |
0.41 |
| ssbA | Streptococcus mutans UA159 |
41.007 |
100 |
0.41 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.007 |
100 |
0.41 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.007 |
100 |
0.41 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.288 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.288 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.288 |
100 |
0.403 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.288 |
100 |
0.403 |