Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | FOB78_RS11110 | Genome accession | NZ_CP044090 |
| Coordinates | 2088873..2089289 (+) | Length | 138 a.a. |
| NCBI ID | WP_000609565.1 | Uniprot ID | Q8DXI7 |
| Organism | Streptococcus agalactiae strain FDAARGOS_670 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2078962..2112726 | 2088873..2089289 | within | 0 |
Gene organization within MGE regions
Location: 2078962..2112726
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOB78_RS11010 (FOB78_11010) | - | 2078962..2080032 (-) | 1071 | WP_000179397.1 | site-specific integrase | - |
| FOB78_RS11015 (FOB78_11015) | - | 2080154..2080558 (-) | 405 | WP_001173134.1 | DUF4429 domain-containing protein | - |
| FOB78_RS11020 (FOB78_11020) | - | 2080611..2080991 (-) | 381 | WP_000762727.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FOB78_RS11025 (FOB78_11025) | - | 2080998..2081360 (-) | 363 | WP_000114553.1 | helix-turn-helix transcriptional regulator | - |
| FOB78_RS11035 (FOB78_11035) | - | 2081646..2081810 (+) | 165 | WP_000511144.1 | hypothetical protein | - |
| FOB78_RS11040 (FOB78_11040) | - | 2081793..2082263 (-) | 471 | WP_001052630.1 | hypothetical protein | - |
| FOB78_RS11045 (FOB78_11045) | - | 2082324..2082533 (+) | 210 | WP_000082755.1 | helix-turn-helix transcriptional regulator | - |
| FOB78_RS11050 (FOB78_11050) | - | 2082536..2083246 (+) | 711 | WP_001002368.1 | ORF6C domain-containing protein | - |
| FOB78_RS11055 (FOB78_11055) | - | 2083306..2083590 (+) | 285 | WP_000998973.1 | hypothetical protein | - |
| FOB78_RS11060 (FOB78_11060) | - | 2083607..2083822 (+) | 216 | WP_001061697.1 | hypothetical protein | - |
| FOB78_RS11065 (FOB78_11065) | dnaB | 2083831..2085162 (+) | 1332 | WP_000343908.1 | replicative DNA helicase | - |
| FOB78_RS11070 (FOB78_11070) | - | 2085165..2085767 (+) | 603 | WP_071661720.1 | hypothetical protein | - |
| FOB78_RS11075 (FOB78_11075) | - | 2085745..2086491 (+) | 747 | WP_000079054.1 | conserved phage C-terminal domain-containing protein | - |
| FOB78_RS11080 (FOB78_11080) | - | 2086492..2087313 (+) | 822 | WP_001067867.1 | ATP-binding protein | - |
| FOB78_RS11085 (FOB78_11085) | - | 2087313..2087375 (+) | 63 | Protein_2033 | DNA cytosine methyltransferase | - |
| FOB78_RS11090 (FOB78_11090) | - | 2087504..2087995 (+) | 492 | WP_000169322.1 | MazG-like family protein | - |
| FOB78_RS11095 (FOB78_11095) | - | 2087995..2088324 (+) | 330 | WP_000793494.1 | DUF1372 family protein | - |
| FOB78_RS11800 | - | 2088453..2088680 (+) | 228 | WP_070467532.1 | DUF3310 domain-containing protein | - |
| FOB78_RS11105 (FOB78_11105) | - | 2088677..2088883 (+) | 207 | WP_000748199.1 | hypothetical protein | - |
| FOB78_RS11110 (FOB78_11110) | ssb | 2088873..2089289 (+) | 417 | WP_000609565.1 | single-stranded DNA-binding protein | Machinery gene |
| FOB78_RS11120 (FOB78_11120) | ltrA | 2089870..2091189 (+) | 1320 | WP_000561483.1 | group II intron reverse transcriptase/maturase | - |
| FOB78_RS11125 (FOB78_11125) | - | 2091322..2091582 (+) | 261 | WP_001008140.1 | hypothetical protein | - |
| FOB78_RS11130 (FOB78_11130) | - | 2091579..2091926 (+) | 348 | WP_000776714.1 | helix-turn-helix domain-containing protein | - |
| FOB78_RS11135 (FOB78_11135) | - | 2091923..2092387 (+) | 465 | WP_000163169.1 | hypothetical protein | - |
| FOB78_RS11140 (FOB78_11140) | - | 2092497..2093039 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| FOB78_RS11145 (FOB78_11145) | - | 2093329..2093616 (+) | 288 | WP_000651009.1 | hypothetical protein | - |
| FOB78_RS11150 (FOB78_11150) | - | 2093739..2093975 (+) | 237 | WP_223846017.1 | HNH endonuclease | - |
| FOB78_RS11155 (FOB78_11155) | - | 2094063..2094548 (+) | 486 | WP_000601035.1 | hypothetical protein | - |
| FOB78_RS11160 (FOB78_11160) | - | 2094541..2096253 (+) | 1713 | WP_000230004.1 | terminase TerL endonuclease subunit | - |
| FOB78_RS11165 (FOB78_11165) | - | 2096262..2097404 (+) | 1143 | WP_001067328.1 | phage portal protein | - |
| FOB78_RS11170 (FOB78_11170) | - | 2097454..2097996 (+) | 543 | WP_000413200.1 | HK97 family phage prohead protease | - |
| FOB78_RS11175 (FOB78_11175) | - | 2098007..2099269 (+) | 1263 | WP_000749070.1 | phage major capsid protein | - |
| FOB78_RS11180 (FOB78_11180) | - | 2099290..2099625 (+) | 336 | WP_000153862.1 | hypothetical protein | - |
| FOB78_RS11185 (FOB78_11185) | - | 2099622..2099927 (+) | 306 | WP_000842789.1 | head-tail adaptor protein | - |
| FOB78_RS11190 (FOB78_11190) | - | 2099927..2100274 (+) | 348 | WP_001074486.1 | hypothetical protein | - |
| FOB78_RS11195 (FOB78_11195) | - | 2100261..2100605 (+) | 345 | WP_000508738.1 | hypothetical protein | - |
| FOB78_RS11200 (FOB78_11200) | - | 2100620..2101303 (+) | 684 | WP_071661714.1 | phage tail protein | - |
| FOB78_RS11205 (FOB78_11205) | - | 2101303..2101779 (+) | 477 | WP_000591558.1 | hypothetical protein | - |
| FOB78_RS11940 (FOB78_11210) | - | 2101818..2101946 (+) | 129 | WP_011058372.1 | hypothetical protein | - |
| FOB78_RS11215 (FOB78_11215) | - | 2101965..2104700 (+) | 2736 | WP_071661713.1 | phage tail tape measure protein | - |
| FOB78_RS11220 (FOB78_11220) | - | 2104697..2105419 (+) | 723 | WP_000161557.1 | hypothetical protein | - |
| FOB78_RS11225 (FOB78_11225) | - | 2105420..2109094 (+) | 3675 | WP_071661712.1 | phage tail spike protein | - |
| FOB78_RS11230 (FOB78_11230) | - | 2109111..2109341 (+) | 231 | WP_001071121.1 | hypothetical protein | - |
| FOB78_RS11235 (FOB78_11235) | - | 2109344..2109682 (+) | 339 | WP_000213866.1 | hypothetical protein | - |
| FOB78_RS11240 (FOB78_11240) | - | 2109717..2110127 (+) | 411 | WP_001135353.1 | hypothetical protein | - |
| FOB78_RS11245 (FOB78_11245) | - | 2110130..2110459 (+) | 330 | WP_000192161.1 | phage holin | - |
| FOB78_RS11250 (FOB78_11250) | - | 2110463..2111869 (+) | 1407 | WP_000405192.1 | peptidoglycan amidohydrolase family protein | - |
| FOB78_RS11255 (FOB78_11255) | - | 2112076..2112261 (+) | 186 | WP_000139836.1 | type II toxin-antitoxin system HicA family toxin | - |
| FOB78_RS11260 (FOB78_11260) | - | 2112322..2112726 (+) | 405 | WP_000878126.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15674.52 Da Isoelectric Point: 4.6604
>NTDB_id=387647 FOB78_RS11110 WP_000609565.1 2088873..2089289(+) (ssb) [Streptococcus agalactiae strain FDAARGOS_670]
MINNVVLIGRLTRDVELRYTPSNIANATFNLAVNRNFKNAAGDREADFINCVMWRQQAENLANWTKKGMLIGITGRIQTR
SYENQQGQRIYVTEVVADSFQILEKRDNSTNQASMDDQLPPSFGNSQPMDISDDDLPF
MINNVVLIGRLTRDVELRYTPSNIANATFNLAVNRNFKNAAGDREADFINCVMWRQQAENLANWTKKGMLIGITGRIQTR
SYENQQGQRIYVTEVVADSFQILEKRDNSTNQASMDDQLPPSFGNSQPMDISDDDLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=387647 FOB78_RS11110 WP_000609565.1 2088873..2089289(+) (ssb) [Streptococcus agalactiae strain FDAARGOS_670]
ATGATCAATAATGTTGTACTTATTGGCCGCTTGACAAGAGATGTTGAGCTACGTTACACGCCGTCAAACATCGCAAACGC
TACTTTTAACCTAGCAGTCAATCGAAATTTCAAGAATGCTGCTGGTGATCGTGAAGCTGATTTCATCAACTGTGTGATGT
GGCGACAACAAGCTGAAAACTTGGCCAATTGGACGAAAAAAGGAATGCTGATTGGTATTACTGGACGAATCCAGACAAGA
AGCTACGAAAATCAGCAAGGTCAGCGTATCTATGTGACTGAGGTTGTTGCTGACAGCTTCCAGATTCTTGAAAAGCGTGA
TAATTCAACGAACCAGGCAAGCATGGATGACCAATTGCCACCATCATTTGGAAATAGTCAGCCTATGGATATTTCAGATG
ATGATCTACCGTTTTGA
ATGATCAATAATGTTGTACTTATTGGCCGCTTGACAAGAGATGTTGAGCTACGTTACACGCCGTCAAACATCGCAAACGC
TACTTTTAACCTAGCAGTCAATCGAAATTTCAAGAATGCTGCTGGTGATCGTGAAGCTGATTTCATCAACTGTGTGATGT
GGCGACAACAAGCTGAAAACTTGGCCAATTGGACGAAAAAAGGAATGCTGATTGGTATTACTGGACGAATCCAGACAAGA
AGCTACGAAAATCAGCAAGGTCAGCGTATCTATGTGACTGAGGTTGTTGCTGACAGCTTCCAGATTCTTGAAAAGCGTGA
TAATTCAACGAACCAGGCAAGCATGGATGACCAATTGCCACCATCATTTGGAAATAGTCAGCCTATGGATATTTCAGATG
ATGATCTACCGTTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.575 |
100 |
0.638 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.259 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.717 |
76.812 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.559 |
100 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.559 |
100 |
0.42 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.943 |
76.812 |
0.391 |