Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | SP670_RS10785 | Genome accession | NC_014498 |
| Coordinates | 1989514..1989780 (-) | Length | 88 a.a. |
| NCBI ID | WP_000962026.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae 670-6B | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1990271..2039649 | 1989514..1989780 | flank | 491 |
Gene organization within MGE regions
Location: 1989514..2039649
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SP670_RS10785 (SP670_2131) | comGC/cglC | 1989514..1989780 (-) | 267 | WP_000962026.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SP670_RS10790 (SP670_2132) | - | 1989782..1990039 (-) | 258 | WP_000698513.1 | hypothetical protein | - |
| SP670_RS10795 (SP670_2133) | - | 1990271..1991227 (-) | 957 | WP_000350474.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| SP670_RS10800 (SP670_2134) | - | 1991227..1991562 (-) | 336 | WP_001186218.1 | phage holin | - |
| SP670_RS10805 (SP670_2135) | - | 1991566..1991865 (-) | 300 | WP_001811580.1 | hypothetical protein | - |
| SP670_RS10810 (SP670_2136) | - | 1991874..1992224 (-) | 351 | WP_000852245.1 | hypothetical protein | - |
| SP670_RS10815 (SP670_2137) | - | 1992227..1992430 (-) | 204 | WP_001091115.1 | hypothetical protein | - |
| SP670_RS14675 (SP670_2138) | - | 1992411..1992527 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| SP670_RS14360 (SP670_2139) | - | 1992524..1999534 (-) | 7011 | WP_408672789.1 | tail fiber domain-containing protein | - |
| SP670_RS10830 (SP670_2140) | - | 1999809..2000159 (-) | 351 | WP_000068026.1 | DUF6711 family protein | - |
| SP670_RS10835 (SP670_2141) | - | 2000168..2003821 (-) | 3654 | WP_000212173.1 | hypothetical protein | - |
| SP670_RS10840 (SP670_2142) | - | 2003808..2004158 (-) | 351 | WP_000478016.1 | hypothetical protein | - |
| SP670_RS10845 (SP670_2143) | - | 2004197..2004577 (-) | 381 | WP_001185632.1 | DUF6096 family protein | - |
| SP670_RS10850 (SP670_2144) | - | 2004582..2004995 (-) | 414 | WP_000880675.1 | hypothetical protein | - |
| SP670_RS10855 (SP670_2145) | - | 2004998..2005366 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| SP670_RS10860 | - | 2005363..2005878 (-) | 516 | WP_000015941.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SP670_RS10865 (SP670_2147) | - | 2005853..2006191 (-) | 339 | WP_000478945.1 | hypothetical protein | - |
| SP670_RS10870 | - | 2006172..2006483 (-) | 312 | WP_000021220.1 | phage head-tail connector protein | - |
| SP670_RS10875 (SP670_2148) | - | 2006485..2006673 (-) | 189 | WP_000669352.1 | hypothetical protein | - |
| SP670_RS10880 (SP670_2149) | - | 2006663..2006845 (-) | 183 | WP_000054935.1 | Rho termination factor N-terminal domain-containing protein | - |
| SP670_RS10885 (SP670_2150) | - | 2006857..2007699 (-) | 843 | WP_000123892.1 | N4-gp56 family major capsid protein | - |
| SP670_RS10890 (SP670_2151) | - | 2007705..2008289 (-) | 585 | WP_001288026.1 | DUF4355 domain-containing protein | - |
| SP670_RS10895 (SP670_2152) | - | 2008516..2008767 (-) | 252 | WP_000890163.1 | DUF6275 family protein | - |
| SP670_RS10900 (SP670_2153) | - | 2008769..2009032 (-) | 264 | WP_000877355.1 | hypothetical protein | - |
| SP670_RS10905 (SP670_2154) | - | 2009075..2009488 (-) | 414 | WP_000565276.1 | HD domain-containing protein | - |
| SP670_RS10910 (SP670_2155) | - | 2009485..2009694 (-) | 210 | WP_000651747.1 | hypothetical protein | - |
| SP670_RS10915 (SP670_2156) | - | 2009696..2011333 (-) | 1638 | WP_192928357.1 | minor capsid protein | - |
| SP670_RS10920 (SP670_2157) | - | 2011242..2012711 (-) | 1470 | WP_000285395.1 | phage portal protein | - |
| SP670_RS10925 (SP670_2158) | - | 2012723..2014021 (-) | 1299 | WP_000084428.1 | PBSX family phage terminase large subunit | - |
| SP670_RS10930 (SP670_2159) | - | 2013999..2014439 (-) | 441 | WP_014931818.1 | terminase small subunit | - |
| SP670_RS10935 (SP670_2160) | - | 2014913..2015335 (-) | 423 | WP_001030244.1 | DUF1492 domain-containing protein | - |
| SP670_RS10940 | - | 2015405..2015770 (-) | 366 | WP_000802874.1 | hypothetical protein | - |
| SP670_RS13950 (SP670_2161) | - | 2015767..2016087 (-) | 321 | WP_001268497.1 | hypothetical protein | - |
| SP670_RS10955 | - | 2016343..2016522 (-) | 180 | WP_001042650.1 | hypothetical protein | - |
| SP670_RS10960 (SP670_2162) | - | 2016515..2016910 (-) | 396 | WP_000612391.1 | YopX family protein | - |
| SP670_RS13955 (SP670_2163) | - | 2016925..2017098 (-) | 174 | WP_000389223.1 | hypothetical protein | - |
| SP670_RS10965 (SP670_2164) | - | 2017098..2017307 (-) | 210 | WP_000160162.1 | hypothetical protein | - |
| SP670_RS10970 (SP670_2165) | - | 2017308..2017979 (-) | 672 | WP_000772902.1 | DUF1642 domain-containing protein | - |
| SP670_RS10975 (SP670_2166) | - | 2017969..2018298 (-) | 330 | WP_000969678.1 | hypothetical protein | - |
| SP670_RS10980 (SP670_2167) | - | 2018343..2018765 (-) | 423 | WP_000167804.1 | hypothetical protein | - |
| SP670_RS10985 (SP670_2168) | - | 2018809..2019237 (-) | 429 | WP_000779139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SP670_RS10990 (SP670_2169) | - | 2019234..2019563 (-) | 330 | WP_000157072.1 | hypothetical protein | - |
| SP670_RS10995 (SP670_2170) | - | 2019577..2019786 (-) | 210 | WP_000455270.1 | hypothetical protein | - |
| SP670_RS11000 (SP670_2171) | - | 2019752..2020258 (-) | 507 | WP_000034831.1 | class I SAM-dependent methyltransferase | - |
| SP670_RS11005 (SP670_2172) | ssbA | 2020268..2020684 (-) | 417 | WP_000609561.1 | single-stranded DNA-binding protein | Machinery gene |
| SP670_RS11010 | - | 2020779..2021114 (-) | 336 | WP_000598346.1 | sporulation protein Cse60 | - |
| SP670_RS11015 (SP670_2174) | - | 2021107..2021430 (-) | 324 | WP_001838362.1 | hypothetical protein | - |
| SP670_RS11020 (SP670_2175) | - | 2021598..2022638 (-) | 1041 | WP_001157037.1 | DUF1351 domain-containing protein | - |
| SP670_RS11025 (SP670_2176) | bet | 2022648..2023466 (-) | 819 | WP_000184002.1 | phage recombination protein Bet | - |
| SP670_RS13960 (SP670_2177) | - | 2023589..2023750 (-) | 162 | WP_013315464.1 | hypothetical protein | - |
| SP670_RS11030 (SP670_2178) | - | 2023743..2023997 (-) | 255 | WP_000471458.1 | hypothetical protein | - |
| SP670_RS11035 (SP670_2179) | - | 2023990..2024193 (-) | 204 | WP_000771953.1 | hypothetical protein | - |
| SP670_RS13965 (SP670_2180) | - | 2024193..2024354 (-) | 162 | WP_000859598.1 | BOW99_gp33 family protein | - |
| SP670_RS11040 (SP670_2181) | - | 2024426..2025142 (-) | 717 | WP_001004043.1 | phage antirepressor KilAC domain-containing protein | - |
| SP670_RS11045 (SP670_2182) | - | 2025166..2025369 (-) | 204 | WP_001247819.1 | hypothetical protein | - |
| SP670_RS11050 | - | 2025619..2025939 (-) | 321 | WP_223687705.1 | HTH domain-containing protein | - |
| SP670_RS11055 (SP670_2183) | - | 2026054..2026260 (-) | 207 | WP_000041498.1 | helix-turn-helix transcriptional regulator | - |
| SP670_RS11060 (SP670_2184) | - | 2026411..2026572 (+) | 162 | WP_226323615.1 | hypothetical protein | - |
| SP670_RS13970 (SP670_2185) | - | 2026565..2026735 (-) | 171 | WP_000656630.1 | hypothetical protein | - |
| SP670_RS13975 | - | 2026732..2026875 (-) | 144 | WP_000389590.1 | hypothetical protein | - |
| SP670_RS14525 (SP670_2186) | - | 2027270..2027392 (-) | 123 | WP_001003831.1 | hypothetical protein | - |
| SP670_RS11065 (SP670_2187) | - | 2027469..2027744 (-) | 276 | WP_001094376.1 | hypothetical protein | - |
| SP670_RS11070 (SP670_2188) | - | 2027906..2028673 (+) | 768 | WP_000862003.1 | S24 family peptidase | - |
| SP670_RS11075 | - | 2028675..2028875 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| SP670_RS11080 (SP670_2190) | - | 2029057..2030502 (+) | 1446 | WP_000633509.1 | recombinase family protein | - |
| SP670_RS11085 (SP670_2191) | comGB/cglB | 2030584..2031600 (-) | 1017 | WP_000355367.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SP670_RS11090 (SP670_2192) | comGA/cglA/cilD | 2031548..2032489 (-) | 942 | WP_000249563.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SP670_RS11095 (SP670_2193) | - | 2032565..2032930 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| SP670_RS11100 (SP670_2194) | - | 2033081..2034139 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| SP670_RS11105 (SP670_2195) | nagA | 2034302..2035453 (-) | 1152 | WP_001134546.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| SP670_RS11110 (SP670_2196) | - | 2035605..2037422 (-) | 1818 | WP_001220854.1 | acyltransferase family protein | - |
| SP670_RS11115 (SP670_2197) | tgt | 2037520..2038662 (-) | 1143 | WP_001285241.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| SP670_RS11120 (SP670_2198) | - | 2038792..2039649 (+) | 858 | WP_001108852.1 | DUF975 family protein | - |
Sequence
Protein
Download Length: 88 a.a. Molecular weight: 9818.31 Da Isoelectric Point: 7.0116
>NTDB_id=38328 SP670_RS10785 WP_000962026.1 1989514..1989780(-) (comGC/cglC) [Streptococcus pneumoniae 670-6B]
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQADGRITEEQAKAYKEYHDKNG
VANRKVND
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQADGRITEEQAKAYKEYHDKNG
VANRKVND
Nucleotide
Download Length: 267 bp
>NTDB_id=38328 SP670_RS10785 WP_000962026.1 1989514..1989780(-) (comGC/cglC) [Streptococcus pneumoniae 670-6B]
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTACAAGCAGATGGGCGAATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGA
GTAGCAAATCGTAAAGTCAATGATTAA
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTACAAGCAGATGGGCGAATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGA
GTAGCAAATCGTAAAGTCAATGATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
97.727 |
100 |
0.977 |
| comGC/cglC | Streptococcus pneumoniae D39 |
97.727 |
100 |
0.977 |
| comGC/cglC | Streptococcus pneumoniae R6 |
97.727 |
100 |
0.977 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
96.591 |
100 |
0.966 |
| comGC/cglC | Streptococcus mitis SK321 |
93.243 |
84.091 |
0.784 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
91.176 |
77.273 |
0.705 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
72.5 |
90.909 |
0.659 |
| comYC | Streptococcus suis isolate S10 |
68.056 |
81.818 |
0.557 |
| comYC | Streptococcus mutans UA140 |
61.429 |
79.545 |
0.489 |
| comYC | Streptococcus mutans UA159 |
61.429 |
79.545 |
0.489 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
50.667 |
85.227 |
0.432 |
| comGC | Staphylococcus aureus MW2 |
47.826 |
78.409 |
0.375 |
| comGC | Staphylococcus aureus N315 |
47.826 |
78.409 |
0.375 |