Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FQP84_RS10320 | Genome accession | NZ_CP043302 |
| Coordinates | 1977860..1978288 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934784.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 16445 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1969036..2013778 | 1977860..1978288 | within | 0 |
Gene organization within MGE regions
Location: 1969036..2013778
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQP84_RS10250 (FQP84_10250) | - | 1969036..1970133 (+) | 1098 | WP_000275730.1 | glycosyl hydrolase family 28-related protein | - |
| FQP84_RS10255 (FQP84_10255) | - | 1970338..1971048 (+) | 711 | WP_000323156.1 | SLC13 family permease | - |
| FQP84_RS10260 (FQP84_10260) | - | 1971016..1972401 (-) | 1386 | WP_000861313.1 | recombinase family protein | - |
| FQP84_RS15775 | - | 1972608..1972730 (-) | 123 | WP_001077637.1 | hypothetical protein | - |
| FQP84_RS10265 (FQP84_10265) | - | 1972751..1973212 (-) | 462 | WP_000525004.1 | hypothetical protein | - |
| FQP84_RS10270 (FQP84_10270) | - | 1973225..1973539 (-) | 315 | WP_149590289.1 | helix-turn-helix domain-containing protein | - |
| FQP84_RS10275 (FQP84_10275) | - | 1973691..1973927 (+) | 237 | WP_001121027.1 | helix-turn-helix transcriptional regulator | - |
| FQP84_RS10280 (FQP84_10280) | - | 1973941..1974717 (+) | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| FQP84_RS15650 | - | 1974746..1974916 (+) | 171 | WP_000398751.1 | hypothetical protein | - |
| FQP84_RS10285 (FQP84_10285) | - | 1974905..1975114 (-) | 210 | WP_000033736.1 | hypothetical protein | - |
| FQP84_RS10290 (FQP84_10290) | - | 1975171..1975914 (+) | 744 | WP_001148623.1 | phage antirepressor KilAC domain-containing protein | - |
| FQP84_RS10295 (FQP84_10295) | - | 1976090..1976320 (-) | 231 | WP_000395455.1 | hypothetical protein | - |
| FQP84_RS10300 (FQP84_10300) | - | 1976500..1976661 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| FQP84_RS10305 (FQP84_10305) | - | 1976753..1977013 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| FQP84_RS10310 (FQP84_10310) | - | 1977023..1977244 (+) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| FQP84_RS10315 (FQP84_10315) | - | 1977237..1977860 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| FQP84_RS10320 (FQP84_10320) | ssbA | 1977860..1978288 (+) | 429 | WP_000934784.1 | single-stranded DNA-binding protein | Machinery gene |
| FQP84_RS10325 (FQP84_10325) | - | 1978302..1978997 (+) | 696 | WP_054105103.1 | putative HNHc nuclease | - |
| FQP84_RS10330 (FQP84_10330) | - | 1978969..1979772 (+) | 804 | WP_000504988.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FQP84_RS10335 (FQP84_10335) | - | 1979783..1980562 (+) | 780 | WP_149590247.1 | ATP-binding protein | - |
| FQP84_RS10340 (FQP84_10340) | - | 1980556..1980714 (+) | 159 | WP_000256594.1 | hypothetical protein | - |
| FQP84_RS10345 (FQP84_10345) | - | 1980727..1980948 (+) | 222 | WP_001123692.1 | DUF3269 family protein | - |
| FQP84_RS10350 (FQP84_10350) | - | 1980959..1981363 (+) | 405 | WP_000049789.1 | DUF1064 domain-containing protein | - |
| FQP84_RS10355 (FQP84_10355) | - | 1981368..1981553 (+) | 186 | WP_001187266.1 | DUF3113 family protein | - |
| FQP84_RS10360 (FQP84_10360) | - | 1981554..1981925 (+) | 372 | WP_000241093.1 | SA1788 family PVL leukocidin-associated protein | - |
| FQP84_RS10365 (FQP84_10365) | - | 1981926..1982174 (+) | 249 | WP_001126831.1 | phi PVL orf 51-like protein | - |
| FQP84_RS10370 (FQP84_10370) | - | 1982187..1982591 (+) | 405 | WP_000695764.1 | hypothetical protein | - |
| FQP84_RS10375 (FQP84_10375) | - | 1982588..1982935 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| FQP84_RS10380 (FQP84_10380) | - | 1982932..1983240 (+) | 309 | WP_000144703.1 | hypothetical protein | - |
| FQP84_RS10385 (FQP84_10385) | - | 1983233..1983481 (+) | 249 | WP_001065070.1 | DUF1024 family protein | - |
| FQP84_RS10390 (FQP84_10390) | - | 1983474..1984007 (+) | 534 | WP_000185642.1 | dUTP diphosphatase | - |
| FQP84_RS10395 (FQP84_10395) | - | 1984044..1984289 (+) | 246 | WP_000120374.1 | hypothetical protein | - |
| FQP84_RS10400 (FQP84_10400) | - | 1984286..1984492 (+) | 207 | WP_000195769.1 | DUF1381 domain-containing protein | - |
| FQP84_RS10405 (FQP84_10405) | - | 1984489..1984692 (+) | 204 | WP_001072794.1 | hypothetical protein | - |
| FQP84_RS10410 (FQP84_10410) | rinB | 1984685..1984900 (+) | 216 | WP_001796216.1 | transcriptional activator RinB | - |
| FQP84_RS10415 (FQP84_10415) | - | 1984901..1985047 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| FQP84_RS10420 (FQP84_10420) | - | 1985071..1985493 (+) | 423 | WP_000162696.1 | RinA family phage transcriptional activator | - |
| FQP84_RS10425 (FQP84_10425) | - | 1985680..1986120 (+) | 441 | WP_001003272.1 | terminase small subunit | - |
| FQP84_RS10430 (FQP84_10430) | - | 1986107..1987384 (+) | 1278 | WP_000169945.1 | PBSX family phage terminase large subunit | - |
| FQP84_RS10435 (FQP84_10435) | - | 1987395..1988930 (+) | 1536 | WP_031836389.1 | phage portal protein | - |
| FQP84_RS10440 (FQP84_10440) | - | 1988937..1989932 (+) | 996 | WP_001133044.1 | minor capsid protein | - |
| FQP84_RS10445 (FQP84_10445) | - | 1990005..1990175 (+) | 171 | WP_000072208.1 | hypothetical protein | - |
| FQP84_RS15780 | - | 1990203..1990290 (+) | 88 | Protein_2006 | hypothetical protein | - |
| FQP84_RS10450 (FQP84_10450) | - | 1990284..1990904 (+) | 621 | WP_149590290.1 | DUF4355 domain-containing protein | - |
| FQP84_RS10455 (FQP84_10455) | - | 1990918..1991892 (+) | 975 | WP_031768999.1 | phage major capsid protein | - |
| FQP84_RS10460 (FQP84_10460) | - | 1991914..1992201 (+) | 288 | WP_001114086.1 | hypothetical protein | - |
| FQP84_RS10465 (FQP84_10465) | - | 1992210..1992542 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| FQP84_RS10470 (FQP84_10470) | - | 1992539..1992841 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| FQP84_RS10475 (FQP84_10475) | - | 1992841..1993188 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FQP84_RS10480 (FQP84_10480) | - | 1993200..1993583 (+) | 384 | WP_000188652.1 | hypothetical protein | - |
| FQP84_RS10485 (FQP84_10485) | - | 1993602..1994183 (+) | 582 | WP_149590291.1 | phage major tail protein, TP901-1 family | - |
| FQP84_RS10490 (FQP84_10490) | - | 1994245..1994610 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| FQP84_RS10495 (FQP84_10495) | - | 1994640..1994984 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| FQP84_RS10500 (FQP84_10500) | - | 1995001..1998465 (+) | 3465 | WP_149590292.1 | hypothetical protein | - |
| FQP84_RS10505 (FQP84_10505) | - | 1998478..1999425 (+) | 948 | WP_000350687.1 | phage tail family protein | - |
| FQP84_RS10510 (FQP84_10510) | - | 1999434..2001335 (+) | 1902 | WP_031836391.1 | SGNH/GDSL hydrolase family protein | - |
| FQP84_RS10515 (FQP84_10515) | - | 2001350..2003260 (+) | 1911 | WP_149590293.1 | hypothetical protein | - |
| FQP84_RS10520 (FQP84_10520) | - | 2003260..2005083 (+) | 1824 | WP_149590294.1 | phage baseplate upper protein | - |
| FQP84_RS10525 (FQP84_10525) | - | 2005083..2005460 (+) | 378 | WP_149590295.1 | DUF2977 domain-containing protein | - |
| FQP84_RS10530 (FQP84_10530) | - | 2005464..2005637 (+) | 174 | WP_001800921.1 | XkdX family protein | - |
| FQP84_RS10535 (FQP84_10535) | - | 2005678..2005977 (+) | 300 | WP_000466767.1 | DUF2951 domain-containing protein | - |
| FQP84_RS10540 (FQP84_10540) | - | 2006114..2008006 (+) | 1893 | WP_000524032.1 | glucosaminidase domain-containing protein | - |
| FQP84_RS10545 (FQP84_10545) | - | 2008019..2009191 (+) | 1173 | WP_000276627.1 | BppU family phage baseplate upper protein | - |
| FQP84_RS10550 (FQP84_10550) | - | 2009197..2009592 (+) | 396 | WP_000398874.1 | hypothetical protein | - |
| FQP84_RS10555 (FQP84_10555) | - | 2009649..2010086 (+) | 438 | WP_000354135.1 | phage holin | - |
| FQP84_RS10560 (FQP84_10560) | - | 2010067..2011512 (+) | 1446 | WP_001148142.1 | SH3 domain-containing protein | - |
| FQP84_RS10570 (FQP84_10570) | - | 2012240..2013034 (+) | 795 | WP_000238962.1 | HipA family kinase | - |
| FQP84_RS10575 (FQP84_10575) | - | 2013041..2013778 (+) | 738 | WP_000278828.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16035.56 Da Isoelectric Point: 5.8724
>NTDB_id=382724 FQP84_RS10320 WP_000934784.1 1977860..1978288(+) (ssbA) [Staphylococcus aureus strain 16445]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=382724 FQP84_RS10320 WP_000934784.1 1977860..1978288(+) (ssbA) [Staphylococcus aureus strain 16445]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.613 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |