Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FQP84_RS00225 | Genome accession | NZ_CP043302 |
| Coordinates | 28883..29311 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934784.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 16445 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 10..41932 | 28883..29311 | within | 0 |
Gene organization within MGE regions
Location: 10..41932
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FQP84_RS00010 (FQP84_00010) | - | 10..1884 (-) | 1875 | WP_000524043.1 | glucosaminidase domain-containing protein | - |
| FQP84_RS00015 (FQP84_00015) | - | 2021..2320 (-) | 300 | WP_149590246.1 | DUF2951 domain-containing protein | - |
| FQP84_RS00020 (FQP84_00020) | - | 2361..2534 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| FQP84_RS00025 (FQP84_00025) | - | 2538..2915 (-) | 378 | WP_000705909.1 | DUF2977 domain-containing protein | - |
| FQP84_RS00030 (FQP84_00030) | - | 2915..4738 (-) | 1824 | WP_000634519.1 | BppU family phage baseplate upper protein | - |
| FQP84_RS00035 (FQP84_00035) | - | 4738..6636 (-) | 1899 | WP_000323259.1 | hypothetical protein | - |
| FQP84_RS00040 (FQP84_00040) | - | 6649..8532 (-) | 1884 | WP_001144706.1 | SGNH/GDSL hydrolase family protein | - |
| FQP84_RS00045 (FQP84_00045) | - | 8543..9478 (-) | 936 | WP_000560196.1 | phage tail domain-containing protein | - |
| FQP84_RS00050 (FQP84_00050) | - | 9493..12462 (-) | 2970 | WP_001606770.1 | hypothetical protein | - |
| FQP84_RS00055 (FQP84_00055) | - | 12465..12806 (-) | 342 | WP_001580347.1 | hypothetical protein | - |
| FQP84_RS00060 (FQP84_00060) | - | 12827..13321 (-) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| FQP84_RS00065 (FQP84_00065) | - | 13383..13943 (-) | 561 | WP_001606768.1 | hypothetical protein | - |
| FQP84_RS00070 (FQP84_00070) | - | 13930..14367 (-) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| FQP84_RS00075 (FQP84_00075) | - | 14380..14793 (-) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FQP84_RS00080 (FQP84_00080) | - | 14780..15115 (-) | 336 | WP_000482986.1 | phage head closure protein | - |
| FQP84_RS00085 (FQP84_00085) | - | 15108..15422 (-) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| FQP84_RS00090 (FQP84_00090) | - | 15422..15748 (-) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| FQP84_RS00095 (FQP84_00095) | - | 15765..16589 (-) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| FQP84_RS00100 (FQP84_00100) | - | 16610..17206 (-) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| FQP84_RS00105 (FQP84_00105) | - | 17304..18284 (-) | 981 | WP_001795666.1 | phage head morphogenesis protein | - |
| FQP84_RS00110 (FQP84_00110) | - | 18223..19701 (-) | 1479 | WP_001159668.1 | phage portal protein | - |
| FQP84_RS00115 (FQP84_00115) | - | 19655..20863 (-) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| FQP84_RS15605 (FQP84_00120) | - | 20856..21350 (-) | 495 | WP_000594082.1 | terminase small subunit | - |
| FQP84_RS00125 (FQP84_00125) | - | 21678..22100 (-) | 423 | WP_000162702.1 | RinA family phage transcriptional activator | - |
| FQP84_RS00130 (FQP84_00130) | - | 22124..22270 (-) | 147 | WP_000990005.1 | hypothetical protein | - |
| FQP84_RS15695 | rinB | 22382..22486 (-) | 105 | Protein_26 | transcriptional activator RinB | - |
| FQP84_RS00140 (FQP84_00140) | - | 22479..22682 (-) | 204 | WP_001072794.1 | hypothetical protein | - |
| FQP84_RS00145 (FQP84_00145) | - | 22679..22885 (-) | 207 | WP_000195769.1 | DUF1381 domain-containing protein | - |
| FQP84_RS00150 (FQP84_00150) | - | 22882..23127 (-) | 246 | WP_000120374.1 | hypothetical protein | - |
| FQP84_RS00155 (FQP84_00155) | - | 23164..23697 (-) | 534 | WP_000185642.1 | dUTP diphosphatase | - |
| FQP84_RS00160 (FQP84_00160) | - | 23690..23938 (-) | 249 | WP_001065070.1 | DUF1024 family protein | - |
| FQP84_RS00165 (FQP84_00165) | - | 23931..24239 (-) | 309 | WP_000144703.1 | hypothetical protein | - |
| FQP84_RS00170 (FQP84_00170) | - | 24236..24583 (-) | 348 | WP_000979209.1 | YopX family protein | - |
| FQP84_RS00175 (FQP84_00175) | - | 24580..24984 (-) | 405 | WP_000695764.1 | hypothetical protein | - |
| FQP84_RS00180 (FQP84_00180) | - | 24997..25245 (-) | 249 | WP_001126831.1 | phi PVL orf 51-like protein | - |
| FQP84_RS00185 (FQP84_00185) | - | 25246..25617 (-) | 372 | WP_000241093.1 | SA1788 family PVL leukocidin-associated protein | - |
| FQP84_RS00190 (FQP84_00190) | - | 25618..25803 (-) | 186 | WP_001187266.1 | DUF3113 family protein | - |
| FQP84_RS00195 (FQP84_00195) | - | 25808..26212 (-) | 405 | WP_000049789.1 | DUF1064 domain-containing protein | - |
| FQP84_RS00200 (FQP84_00200) | - | 26223..26444 (-) | 222 | WP_001123692.1 | DUF3269 family protein | - |
| FQP84_RS00205 (FQP84_00205) | - | 26457..26615 (-) | 159 | WP_000256594.1 | hypothetical protein | - |
| FQP84_RS00210 (FQP84_00210) | - | 26609..27388 (-) | 780 | WP_149590247.1 | ATP-binding protein | - |
| FQP84_RS00215 (FQP84_00215) | - | 27399..28202 (-) | 804 | WP_000504988.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FQP84_RS00220 (FQP84_00220) | - | 28174..28869 (-) | 696 | WP_054105103.1 | putative HNHc nuclease | - |
| FQP84_RS00225 (FQP84_00225) | ssbA | 28883..29311 (-) | 429 | WP_000934784.1 | single-stranded DNA-binding protein | Machinery gene |
| FQP84_RS00230 (FQP84_00230) | - | 29311..29934 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| FQP84_RS00235 (FQP84_00235) | - | 29927..30148 (-) | 222 | WP_000815403.1 | DUF2483 family protein | - |
| FQP84_RS00240 (FQP84_00240) | - | 30158..30418 (-) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| FQP84_RS00245 (FQP84_00245) | - | 30510..30671 (-) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| FQP84_RS00250 (FQP84_00250) | - | 30851..31081 (+) | 231 | WP_000395455.1 | hypothetical protein | - |
| FQP84_RS00255 (FQP84_00255) | - | 31257..31997 (-) | 741 | WP_001606750.1 | phage antirepressor KilAC domain-containing protein | - |
| FQP84_RS00260 (FQP84_00260) | - | 31999..32184 (-) | 186 | WP_000933364.1 | helix-turn-helix domain-containing protein | - |
| FQP84_RS15610 | - | 32626..32796 (+) | 171 | WP_001280594.1 | hypothetical protein | - |
| FQP84_RS15615 | - | 32757..32918 (-) | 162 | WP_001153176.1 | hypothetical protein | - |
| FQP84_RS00265 (FQP84_00265) | - | 32952..33398 (-) | 447 | WP_000435350.1 | hypothetical protein | - |
| FQP84_RS00270 (FQP84_00270) | - | 33411..33659 (-) | 249 | WP_000272858.1 | helix-turn-helix domain-containing protein | - |
| FQP84_RS00275 (FQP84_00275) | - | 33823..34146 (+) | 324 | WP_001260487.1 | helix-turn-helix domain-containing protein | - |
| FQP84_RS00280 (FQP84_00280) | - | 34159..34620 (+) | 462 | WP_000525009.1 | hypothetical protein | - |
| FQP84_RS00285 (FQP84_00285) | - | 34638..35141 (+) | 504 | WP_000825944.1 | hypothetical protein | - |
| FQP84_RS00290 (FQP84_00290) | - | 35385..36770 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
| FQP84_RS00295 (FQP84_00295) | rpmF | 36887..37060 (-) | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| FQP84_RS00305 (FQP84_00305) | - | 37140..37697 (-) | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| FQP84_RS00310 (FQP84_00310) | - | 37824..38963 (+) | 1140 | WP_000843611.1 | nucleotidyltransferase | - |
| FQP84_RS00315 (FQP84_00315) | coaD | 39025..39507 (-) | 483 | WP_000401377.1 | pantetheine-phosphate adenylyltransferase | - |
| FQP84_RS00320 (FQP84_00320) | rsmD | 39509..40051 (-) | 543 | WP_001263796.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| FQP84_RS00325 (FQP84_00325) | - | 40121..40510 (+) | 390 | WP_000814565.1 | hypothetical protein | - |
| FQP84_RS00330 (FQP84_00330) | - | 40513..40767 (-) | 255 | WP_001049149.1 | YlbG family protein | - |
| FQP84_RS00335 (FQP84_00335) | - | 41006..41932 (+) | 927 | WP_000757569.1 | glycerophosphodiester phosphodiesterase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16035.56 Da Isoelectric Point: 5.8724
>NTDB_id=382701 FQP84_RS00225 WP_000934784.1 28883..29311(-) (ssbA) [Staphylococcus aureus strain 16445]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=382701 FQP84_RS00225 WP_000934784.1 28883..29311(-) (ssbA) [Staphylococcus aureus strain 16445]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.613 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.657 |
100 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |