Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FP484_RS07235 | Genome accession | NZ_CP042107 |
| Coordinates | 1434813..1435238 (+) | Length | 141 a.a. |
| NCBI ID | WP_145398816.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain B8-13D | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1423718..1468071 | 1434813..1435238 | within | 0 |
Gene organization within MGE regions
Location: 1423718..1468071
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FP484_RS07145 (FP484_07145) | sufB | 1423718..1425115 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| FP484_RS07150 (FP484_07150) | - | 1425183..1426232 (-) | 1050 | WP_114306610.1 | tyrosine-type recombinase/integrase | - |
| FP484_RS07155 (FP484_07155) | - | 1426293..1427951 (-) | 1659 | WP_017431789.1 | DpnII family type II restriction endonuclease | - |
| FP484_RS07160 (FP484_07160) | - | 1428043..1428228 (-) | 186 | WP_114306611.1 | hypothetical protein | - |
| FP484_RS14530 | - | 1428278..1428412 (-) | 135 | WP_255777535.1 | hypothetical protein | - |
| FP484_RS07165 (FP484_07165) | - | 1428424..1429131 (-) | 708 | WP_029549355.1 | S24 family peptidase | - |
| FP484_RS07170 (FP484_07170) | - | 1429302..1429541 (+) | 240 | WP_000548576.1 | helix-turn-helix transcriptional regulator | - |
| FP484_RS07175 (FP484_07175) | - | 1429554..1429997 (+) | 444 | WP_000435347.1 | hypothetical protein | - |
| FP484_RS07180 (FP484_07180) | - | 1430012..1430155 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| FP484_RS07185 (FP484_07185) | - | 1430165..1430767 (-) | 603 | WP_145398805.1 | hypothetical protein | - |
| FP484_RS07190 (FP484_07190) | - | 1431210..1431395 (+) | 186 | WP_000933364.1 | helix-turn-helix domain-containing protein | - |
| FP484_RS07195 (FP484_07195) | - | 1431397..1432146 (+) | 750 | WP_001148587.1 | phage antirepressor KilAC domain-containing protein | - |
| FP484_RS07200 (FP484_07200) | - | 1432187..1432477 (+) | 291 | WP_000405222.1 | hypothetical protein | - |
| FP484_RS14405 | - | 1432489..1432659 (-) | 171 | WP_000224747.1 | hypothetical protein | - |
| FP484_RS07205 (FP484_07205) | - | 1432730..1432951 (+) | 222 | WP_000594790.1 | hypothetical protein | - |
| FP484_RS07210 (FP484_07210) | - | 1432944..1433105 (+) | 162 | WP_031795048.1 | DUF1270 family protein | - |
| FP484_RS07215 (FP484_07215) | - | 1433199..1433459 (+) | 261 | WP_031795049.1 | DUF1108 family protein | - |
| FP484_RS07220 (FP484_07220) | - | 1433467..1433703 (+) | 237 | WP_000802315.1 | hypothetical protein | - |
| FP484_RS07225 (FP484_07225) | - | 1433696..1434175 (+) | 480 | WP_145398808.1 | siphovirus Gp157 family protein | - |
| FP484_RS07230 (FP484_07230) | - | 1434175..1434813 (+) | 639 | WP_145398813.1 | ERF family protein | - |
| FP484_RS07235 (FP484_07235) | ssbA | 1434813..1435238 (+) | 426 | WP_145398816.1 | single-stranded DNA-binding protein | Machinery gene |
| FP484_RS07240 (FP484_07240) | - | 1435252..1435926 (+) | 675 | WP_042743981.1 | putative HNHc nuclease | - |
| FP484_RS07245 (FP484_07245) | - | 1436036..1436695 (-) | 660 | WP_016028252.1 | hypothetical protein | - |
| FP484_RS07250 (FP484_07250) | - | 1436741..1437511 (+) | 771 | WP_031879778.1 | conserved phage C-terminal domain-containing protein | - |
| FP484_RS07255 (FP484_07255) | - | 1437521..1438294 (+) | 774 | WP_000803028.1 | ATP-binding protein | - |
| FP484_RS07260 (FP484_07260) | - | 1438288..1438446 (+) | 159 | WP_000256597.1 | hypothetical protein | - |
| FP484_RS07265 (FP484_07265) | - | 1438460..1438681 (+) | 222 | WP_001123681.1 | DUF3269 family protein | - |
| FP484_RS07270 (FP484_07270) | - | 1438674..1439096 (+) | 423 | WP_114306624.1 | DUF1064 domain-containing protein | - |
| FP484_RS07275 (FP484_07275) | - | 1439101..1439286 (+) | 186 | WP_031880123.1 | DUF3113 family protein | - |
| FP484_RS07280 (FP484_07280) | - | 1439287..1439655 (+) | 369 | WP_114306615.1 | SA1788 family PVL leukocidin-associated protein | - |
| FP484_RS07285 (FP484_07285) | - | 1439659..1439901 (+) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| FP484_RS07290 (FP484_07290) | - | 1439914..1440318 (+) | 405 | WP_001560892.1 | hypothetical protein | - |
| FP484_RS07295 (FP484_07295) | - | 1440315..1440662 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| FP484_RS07300 (FP484_07300) | - | 1440659..1440967 (+) | 309 | WP_000144708.1 | hypothetical protein | - |
| FP484_RS14410 | - | 1440960..1441097 (+) | 138 | Protein_1417 | DUF1024 family protein | - |
| FP484_RS14415 | - | 1441095..1441301 (+) | 207 | WP_186365000.1 | DUF1381 domain-containing protein | - |
| FP484_RS07310 (FP484_07310) | rinB | 1441294..1441467 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| FP484_RS07315 (FP484_07315) | - | 1441468..1441869 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| FP484_RS07325 (FP484_07325) | - | 1442222..1442716 (+) | 495 | WP_031912631.1 | terminase small subunit | - |
| FP484_RS07330 (FP484_07330) | - | 1442709..1443077 (+) | 369 | Protein_1422 | PBSX family phage terminase large subunit | - |
| FP484_RS07335 (FP484_07335) | - | 1443197..1444036 (+) | 840 | WP_114306617.1 | NUMOD3 domain-containing DNA-binding protein | - |
| FP484_RS07340 (FP484_07340) | - | 1444232..1445086 (+) | 855 | Protein_1424 | PBSX family phage terminase large subunit | - |
| FP484_RS07345 (FP484_07345) | - | 1445083..1446507 (+) | 1425 | WP_000177422.1 | phage portal protein | - |
| FP484_RS07350 (FP484_07350) | - | 1446476..1447426 (+) | 951 | WP_114306618.1 | phage head morphogenesis protein | - |
| FP484_RS07355 (FP484_07355) | - | 1447430..1447663 (+) | 234 | WP_000440857.1 | hypothetical protein | - |
| FP484_RS07360 (FP484_07360) | - | 1447767..1448351 (+) | 585 | WP_001019222.1 | DUF4355 domain-containing protein | - |
| FP484_RS07365 (FP484_07365) | - | 1448368..1449282 (+) | 915 | WP_000235170.1 | phage major capsid protein | - |
| FP484_RS14420 | - | 1449294..1449437 (+) | 144 | WP_000002930.1 | hypothetical protein | - |
| FP484_RS07370 (FP484_07370) | - | 1449443..1449793 (+) | 351 | WP_000177353.1 | phage head-tail adapter protein | - |
| FP484_RS07375 (FP484_07375) | - | 1449805..1450140 (+) | 336 | WP_000483043.1 | phage head closure protein | - |
| FP484_RS07380 (FP484_07380) | - | 1450127..1450357 (+) | 231 | Protein_1433 | HK97 gp10 family phage protein | - |
| FP484_RS07385 (FP484_07385) | - | 1450538..1451152 (+) | 615 | WP_145373937.1 | GIY-YIG nuclease family protein | - |
| FP484_RS07390 (FP484_07390) | - | 1451288..1451470 (+) | 183 | Protein_1435 | HK97 gp10 family phage protein | - |
| FP484_RS07395 (FP484_07395) | - | 1451483..1451908 (+) | 426 | WP_000270186.1 | DUF3168 domain-containing protein | - |
| FP484_RS07400 (FP484_07400) | - | 1451909..1452466 (+) | 558 | WP_000057585.1 | hypothetical protein | - |
| FP484_RS07405 (FP484_07405) | - | 1452533..1453045 (+) | 513 | WP_000134335.1 | tail assembly chaperone | - |
| FP484_RS14535 | - | 1453225..1453374 (+) | 150 | WP_000090305.1 | hypothetical protein | - |
| FP484_RS07415 (FP484_07415) | - | 1453378..1456263 (+) | 2886 | WP_000379436.1 | hypothetical protein | - |
| FP484_RS07420 (FP484_07420) | - | 1456278..1457219 (+) | 942 | WP_000560186.1 | phage tail domain-containing protein | - |
| FP484_RS07425 (FP484_07425) | - | 1457230..1459116 (+) | 1887 | WP_001122007.1 | SGNH/GDSL hydrolase family protein | - |
| FP484_RS07430 (FP484_07430) | - | 1459129..1461027 (+) | 1899 | WP_000323263.1 | hypothetical protein | - |
| FP484_RS07435 (FP484_07435) | - | 1461027..1462850 (+) | 1824 | WP_031794946.1 | phage baseplate upper protein | - |
| FP484_RS07440 (FP484_07440) | - | 1462850..1463227 (+) | 378 | WP_114306621.1 | DUF2977 domain-containing protein | - |
| FP484_RS07445 (FP484_07445) | - | 1463231..1463404 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| FP484_RS07450 (FP484_07450) | - | 1463445..1463744 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| FP484_RS07455 (FP484_07455) | - | 1463881..1465755 (+) | 1875 | WP_031794945.1 | glucosaminidase domain-containing protein | - |
| FP484_RS14425 | - | 1465768..1466016 (+) | 249 | Protein_1449 | BppU family phage baseplate upper protein | - |
| FP484_RS07465 (FP484_07465) | - | 1466208..1466645 (+) | 438 | WP_031794944.1 | phage holin | - |
| FP484_RS07470 (FP484_07470) | - | 1466626..1468071 (+) | 1446 | WP_017431807.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15973.64 Da Isoelectric Point: 6.3912
>NTDB_id=375687 FP484_RS07235 WP_145398816.1 1434813..1435238(+) (ssbA) [Staphylococcus aureus strain B8-13D]
MLNRVVLVGRLTKDPELRSTPNGVSVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQQKNNYQQQRQTQTGNNPFDNTEEDFSDLPF
MLNRVVLVGRLTKDPELRSTPNGVSVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQQKNNYQQQRQTQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=375687 FP484_RS07235 WP_145398816.1 1434813..1435238(+) (ssbA) [Staphylococcus aureus strain B8-13D]
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGTGTAAGTGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTACAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAAAAACAATTATCAACAACAAAGACAAACTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGTGTAAGTGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTACAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAAAAACAATTATCAACAACAAAGACAAACTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
83.178 |
75.887 |
0.631 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.579 |
100 |
0.61 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
75.177 |
0.447 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.435 |
81.56 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
49.565 |
81.56 |
0.404 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.458 |
83.688 |
0.397 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.458 |
83.688 |
0.397 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
46.61 |
83.688 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
46.61 |
83.688 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
46.61 |
83.688 |
0.39 |
| ssbB/cilA | Streptococcus mitis SK321 |
46.61 |
83.688 |
0.39 |