Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FP478_RS05460 | Genome accession | NZ_CP042043 |
| Coordinates | 1101882..1102310 (+) | Length | 142 a.a. |
| NCBI ID | WP_031795507.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain B2-15A | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1090787..1133858 | 1101882..1102310 | within | 0 |
Gene organization within MGE regions
Location: 1090787..1133858
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FP478_RS05370 (FP478_05370) | sufB | 1090787..1092184 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| FP478_RS05375 (FP478_05375) | - | 1092252..1093301 (-) | 1050 | WP_114306610.1 | tyrosine-type recombinase/integrase | - |
| FP478_RS05380 (FP478_05380) | - | 1093362..1095020 (-) | 1659 | WP_017431789.1 | DpnII family type II restriction endonuclease | - |
| FP478_RS05385 (FP478_05385) | - | 1095112..1095297 (-) | 186 | WP_114306611.1 | hypothetical protein | - |
| FP478_RS14470 | - | 1095347..1095481 (-) | 135 | WP_255777535.1 | hypothetical protein | - |
| FP478_RS05390 (FP478_05390) | - | 1095493..1096200 (-) | 708 | WP_029549355.1 | helix-turn-helix domain-containing protein | - |
| FP478_RS05395 (FP478_05395) | - | 1096371..1096610 (+) | 240 | WP_000548576.1 | helix-turn-helix transcriptional regulator | - |
| FP478_RS05400 (FP478_05400) | - | 1096623..1097066 (+) | 444 | WP_000435347.1 | hypothetical protein | - |
| FP478_RS05405 (FP478_05405) | - | 1097081..1097224 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| FP478_RS05410 (FP478_05410) | - | 1097234..1097836 (-) | 603 | WP_012840514.1 | hypothetical protein | - |
| FP478_RS05415 (FP478_05415) | - | 1098279..1098464 (+) | 186 | WP_000933364.1 | helix-turn-helix domain-containing protein | - |
| FP478_RS05420 (FP478_05420) | - | 1098466..1099215 (+) | 750 | WP_001148587.1 | phage antirepressor KilAC domain-containing protein | - |
| FP478_RS05425 (FP478_05425) | - | 1099256..1099546 (+) | 291 | WP_000405222.1 | hypothetical protein | - |
| FP478_RS14380 | - | 1099558..1099728 (-) | 171 | WP_000224747.1 | hypothetical protein | - |
| FP478_RS05430 (FP478_05430) | - | 1099799..1100020 (+) | 222 | WP_000594790.1 | hypothetical protein | - |
| FP478_RS05435 (FP478_05435) | - | 1100013..1100174 (+) | 162 | WP_031795048.1 | DUF1270 family protein | - |
| FP478_RS05440 (FP478_05440) | - | 1100268..1100528 (+) | 261 | WP_031795049.1 | DUF1108 family protein | - |
| FP478_RS05445 (FP478_05445) | - | 1100536..1100772 (+) | 237 | WP_000802315.1 | hypothetical protein | - |
| FP478_RS05450 (FP478_05450) | - | 1100765..1101244 (+) | 480 | WP_000002513.1 | siphovirus Gp157 family protein | - |
| FP478_RS05455 (FP478_05455) | - | 1101244..1101882 (+) | 639 | WP_001043061.1 | ERF family protein | - |
| FP478_RS05460 (FP478_05460) | ssbA | 1101882..1102310 (+) | 429 | WP_031795507.1 | single-stranded DNA-binding protein | Machinery gene |
| FP478_RS05465 (FP478_05465) | - | 1102324..1102998 (+) | 675 | WP_145391279.1 | putative HNHc nuclease | - |
| FP478_RS05470 (FP478_05470) | - | 1103108..1103767 (-) | 660 | WP_016028252.1 | hypothetical protein | - |
| FP478_RS05475 (FP478_05475) | - | 1103813..1104583 (+) | 771 | WP_031879778.1 | conserved phage C-terminal domain-containing protein | - |
| FP478_RS05480 (FP478_05480) | - | 1104593..1105366 (+) | 774 | WP_000803028.1 | ATP-binding protein | - |
| FP478_RS05485 (FP478_05485) | - | 1105360..1105518 (+) | 159 | WP_000256597.1 | hypothetical protein | - |
| FP478_RS05490 (FP478_05490) | - | 1105532..1105753 (+) | 222 | WP_001123681.1 | DUF3269 family protein | - |
| FP478_RS05495 (FP478_05495) | - | 1105746..1106168 (+) | 423 | WP_114306624.1 | DUF1064 domain-containing protein | - |
| FP478_RS05500 (FP478_05500) | - | 1106173..1106358 (+) | 186 | WP_031880123.1 | DUF3113 family protein | - |
| FP478_RS05505 (FP478_05505) | - | 1106359..1106727 (+) | 369 | WP_114306615.1 | SA1788 family PVL leukocidin-associated protein | - |
| FP478_RS05510 (FP478_05510) | - | 1106731..1106973 (+) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| FP478_RS05515 (FP478_05515) | - | 1106986..1107390 (+) | 405 | WP_001560892.1 | hypothetical protein | - |
| FP478_RS05520 (FP478_05520) | - | 1107387..1107734 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| FP478_RS05525 (FP478_05525) | - | 1107731..1108018 (+) | 288 | WP_145391281.1 | hypothetical protein | - |
| FP478_RS05530 (FP478_05530) | rinB | 1108011..1108184 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| FP478_RS05535 (FP478_05535) | - | 1108185..1108586 (+) | 402 | WP_000286968.1 | hypothetical protein | - |
| FP478_RS05545 (FP478_05545) | - | 1108972..1109433 (+) | 462 | WP_261369555.1 | terminase | - |
| FP478_RS05550 (FP478_05550) | - | 1109426..1109794 (+) | 369 | Protein_1067 | PBSX family phage terminase large subunit | - |
| FP478_RS05555 (FP478_05555) | - | 1109914..1110753 (+) | 840 | WP_114306617.1 | NUMOD3 domain-containing DNA-binding protein | - |
| FP478_RS05560 (FP478_05560) | - | 1110949..1111803 (+) | 855 | Protein_1069 | PBSX family phage terminase large subunit | - |
| FP478_RS05565 (FP478_05565) | - | 1111800..1113224 (+) | 1425 | WP_000177422.1 | phage portal protein | - |
| FP478_RS05570 (FP478_05570) | - | 1113193..1114143 (+) | 951 | WP_114306618.1 | phage head morphogenesis protein | - |
| FP478_RS05575 (FP478_05575) | - | 1114147..1114380 (+) | 234 | WP_000440857.1 | hypothetical protein | - |
| FP478_RS05580 (FP478_05580) | - | 1114484..1115068 (+) | 585 | WP_001019222.1 | DUF4355 domain-containing protein | - |
| FP478_RS05585 (FP478_05585) | - | 1115085..1115999 (+) | 915 | WP_000235170.1 | phage major capsid protein | - |
| FP478_RS14385 | - | 1116011..1116154 (+) | 144 | WP_000002930.1 | hypothetical protein | - |
| FP478_RS05590 (FP478_05590) | - | 1116160..1116510 (+) | 351 | WP_000177353.1 | phage head-tail adapter protein | - |
| FP478_RS05595 (FP478_05595) | - | 1116522..1116857 (+) | 336 | WP_000483043.1 | phage head closure protein | - |
| FP478_RS05600 (FP478_05600) | - | 1116844..1117257 (+) | 414 | WP_001151327.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FP478_RS05605 (FP478_05605) | - | 1117270..1117695 (+) | 426 | WP_000270186.1 | DUF3168 domain-containing protein | - |
| FP478_RS05610 (FP478_05610) | - | 1117696..1118253 (+) | 558 | WP_000057585.1 | hypothetical protein | - |
| FP478_RS05615 (FP478_05615) | - | 1118320..1118832 (+) | 513 | WP_000134335.1 | tail assembly chaperone | - |
| FP478_RS14475 | - | 1119012..1119161 (+) | 150 | WP_000090305.1 | hypothetical protein | - |
| FP478_RS05625 (FP478_05625) | - | 1119165..1122050 (+) | 2886 | WP_000379436.1 | hypothetical protein | - |
| FP478_RS05630 (FP478_05630) | - | 1122065..1123006 (+) | 942 | WP_000560186.1 | phage tail domain-containing protein | - |
| FP478_RS05635 (FP478_05635) | - | 1123017..1124903 (+) | 1887 | WP_001122007.1 | SGNH/GDSL hydrolase family protein | - |
| FP478_RS05640 (FP478_05640) | - | 1124916..1126814 (+) | 1899 | WP_000323263.1 | hypothetical protein | - |
| FP478_RS05645 (FP478_05645) | - | 1126814..1128637 (+) | 1824 | WP_031794946.1 | phage baseplate upper protein | - |
| FP478_RS05650 (FP478_05650) | - | 1128637..1129014 (+) | 378 | WP_000705920.1 | DUF2977 domain-containing protein | - |
| FP478_RS05655 (FP478_05655) | - | 1129018..1129191 (+) | 174 | WP_001790193.1 | XkdX family protein | - |
| FP478_RS05660 (FP478_05660) | - | 1129232..1129531 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| FP478_RS05665 (FP478_05665) | - | 1129668..1131542 (+) | 1875 | WP_031794945.1 | glucosaminidase domain-containing protein | - |
| FP478_RS14390 | - | 1131555..1131803 (+) | 249 | Protein_1092 | BppU family phage baseplate upper protein | - |
| FP478_RS05675 (FP478_05675) | - | 1131995..1132432 (+) | 438 | WP_031794944.1 | phage holin | - |
| FP478_RS05680 (FP478_05680) | - | 1132413..1133858 (+) | 1446 | WP_017431807.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15973.64 Da Isoelectric Point: 7.0144
>NTDB_id=375604 FP478_RS05460 WP_031795507.1 1101882..1102310(+) (ssbA) [Staphylococcus aureus strain B2-15A]
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=375604 FP478_RS05460 WP_031795507.1 1101882..1102310(+) (ssbA) [Staphylococcus aureus strain B2-15A]
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGTACACCAAATGGTGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTACAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGTACACCAAATGGTGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTACAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.884 |
100 |
0.725 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.627 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.056 |
100 |
0.444 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
74.648 |
0.444 |
| ssbA | Streptococcus mutans UA159 |
42.958 |
100 |
0.43 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.549 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.845 |
100 |
0.408 |