Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SARLGA251_RS07810 | Genome accession | NC_017349 |
| Coordinates | 1603068..1603379 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus subsp. aureus LGA251 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1598068..1608379
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SARLGA251_RS07775 (SARLGA251_14420) | gcvPA | 1598570..1599916 (-) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SARLGA251_RS07780 (SARLGA251_14430) | gcvT | 1599936..1601027 (-) | 1092 | WP_000093354.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SARLGA251_RS07785 (SARLGA251_14440) | - | 1601186..1601710 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SARLGA251_RS07790 | - | 1601700..1601846 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SARLGA251_RS07795 (SARLGA251_14450) | comGF | 1601943..1602440 (-) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SARLGA251_RS07800 (SARLGA251_14460) | comGE | 1602358..1602657 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SARLGA251_RS07805 (SARLGA251_14470) | comGD | 1602644..1603090 (-) | 447 | WP_072357807.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SARLGA251_RS07810 (SARLGA251_14480) | comGC | 1603068..1603379 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SARLGA251_RS07815 (SARLGA251_14490) | comGB | 1603393..1604463 (-) | 1071 | WP_000776413.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SARLGA251_RS07820 (SARLGA251_14500) | comGA | 1604435..1605409 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SARLGA251_RS07825 (SARLGA251_14510) | - | 1605461..1606084 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SARLGA251_RS07830 (SARLGA251_14520) | - | 1606081..1606410 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SARLGA251_RS07835 (SARLGA251_14530) | - | 1606410..1607396 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| SARLGA251_RS07840 (SARLGA251_14540) | - | 1607393..1607596 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=37373 SARLGA251_RS07810 WP_000472256.1 1603068..1603379(-) (comGC) [Staphylococcus aureus subsp. aureus LGA251]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=37373 SARLGA251_RS07810 WP_000472256.1 1603068..1603379(-) (comGC) [Staphylococcus aureus subsp. aureus LGA251]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |