Detailed information NTG0373521

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: FO458_RS04885
• Genome accession: NZ_CP041726
• Coordinates: 972585..972899 (+)
• Length: 104 a.a.
• NCBI ID: WP_070648481.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain SL118
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 967585..977899

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FO458_RS04855 (FO458_04855)	-	968377..968580 (+)	204	WP_070648475.1	YqgQ family protein	-
FO458_RS04860 (FO458_04860)	-	968577..969563 (+)	987	WP_070648477.1	ROK family glucokinase	-
FO458_RS04865 (FO458_04865)	-	969563..969886 (+)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
FO458_RS04870 (FO458_04870)	-	969890..970513 (+)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
FO458_RS04875 (FO458_04875)	comGA	970560..971534 (+)	975	WP_002478129.1	competence type IV pilus ATPase ComGA	Machinery gene
FO458_RS04880 (FO458_04880)	comGB	971506..972570 (+)	1065	WP_070648479.1	competence type IV pilus assembly protein ComGB	-
FO458_RS04885 (FO458_04885)	comGC	972585..972899 (+)	315	WP_070648481.1	competence type IV pilus major pilin ComGC	Machinery gene
FO458_RS04890 (FO458_04890)	comGD	972832..973326 (+)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
FO458_RS04895 (FO458_04895)	-	973313..973606 (+)	294	WP_070648483.1	hypothetical protein	-
FO458_RS04900 (FO458_04900)	-	973668..974027 (+)	360	WP_002459019.1	competence type IV pilus minor pilin ComGF	-
FO458_RS04910 (FO458_04910)	-	974181..974699 (+)	519	WP_002459021.1	shikimate kinase	-
FO458_RS04915 (FO458_04915)	gcvT	974870..975961 (+)	1092	WP_037544364.1	glycine cleavage system aminomethyltransferase GcvT	-
FO458_RS04920 (FO458_04920)	gcvPA	975978..977327 (+)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11399.40 Da
• Isoelectric Point: 8.2579

>NTDB_id=373521 FO458_RS04885 WP_070648481.1 972585..972899(+) (comGC) [Staphylococcus lugdunensis strain SL118]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAYVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=373521 FO458_RS04885 WP_070648481.1 972585..972899(+) (comGC) [Staphylococcus lugdunensis strain SL118]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCATATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	81.373	98.077	0.798
comGC	Staphylococcus aureus N315	81.373	98.077	0.798
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375