Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FF959_RS04380 | Genome accession | NZ_CP040623 |
| Coordinates | 888811..889239 (+) | Length | 142 a.a. |
| NCBI ID | WP_000934385.1 | Uniprot ID | A0A2K0CLZ8 |
| Organism | Staphylococcus aureus strain D592-HR | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 878835..926980 | 888811..889239 | within | 0 |
Gene organization within MGE regions
Location: 878835..926980
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FF959_RS04290 (FF959_04290) | sufU | 878835..879299 (+) | 465 | WP_001010508.1 | Fe-S cluster assembly sulfur transfer protein SufU | - |
| FF959_RS04295 (FF959_04295) | sufB | 879450..880847 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| FF959_RS04300 (FF959_04300) | - | 880915..881964 (-) | 1050 | WP_001145726.1 | tyrosine-type recombinase/integrase | - |
| FF959_RS04305 (FF959_04305) | - | 882077..882256 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| FF959_RS04310 (FF959_04310) | - | 882236..883168 (-) | 933 | WP_000392186.1 | hypothetical protein | - |
| FF959_RS04315 (FF959_04315) | - | 883200..883925 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| FF959_RS04320 (FF959_04320) | - | 883953..884627 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FF959_RS04325 (FF959_04325) | - | 884644..884976 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| FF959_RS04330 (FF959_04330) | - | 885239..885433 (+) | 195 | WP_000108122.1 | helix-turn-helix transcriptional regulator | - |
| FF959_RS04335 (FF959_04335) | - | 885433..886200 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| FF959_RS04340 (FF959_04340) | - | 886201..886425 (+) | 225 | WP_000187184.1 | hypothetical protein | - |
| FF959_RS04345 (FF959_04345) | - | 886465..886914 (+) | 450 | WP_001094943.1 | hypothetical protein | - |
| FF959_RS04350 (FF959_04350) | - | 886928..887149 (+) | 222 | WP_000977381.1 | hypothetical protein | - |
| FF959_RS04355 (FF959_04355) | - | 887142..887303 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| FF959_RS04360 (FF959_04360) | - | 887397..887699 (+) | 303 | WP_000165363.1 | DUF2482 family protein | - |
| FF959_RS04365 (FF959_04365) | - | 887704..887964 (+) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| FF959_RS04370 (FF959_04370) | - | 887974..888195 (+) | 222 | WP_000815401.1 | DUF2483 family protein | - |
| FF959_RS04375 (FF959_04375) | - | 888188..888811 (+) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| FF959_RS04380 (FF959_04380) | ssbA | 888811..889239 (+) | 429 | WP_000934385.1 | single-stranded DNA-binding protein | Machinery gene |
| FF959_RS04385 (FF959_04385) | - | 889253..889927 (+) | 675 | WP_001124438.1 | putative HNHc nuclease | - |
| FF959_RS14510 | - | 889924..890073 (+) | 150 | WP_001081076.1 | hypothetical protein | - |
| FF959_RS04390 (FF959_04390) | - | 890066..890347 (-) | 282 | WP_000414755.1 | hypothetical protein | - |
| FF959_RS04395 (FF959_04395) | - | 890413..891183 (+) | 771 | WP_000190254.1 | conserved phage C-terminal domain-containing protein | - |
| FF959_RS04400 (FF959_04400) | - | 891193..891972 (+) | 780 | WP_000803062.1 | ATP-binding protein | - |
| FF959_RS04405 (FF959_04405) | - | 891966..892124 (+) | 159 | WP_000256589.1 | hypothetical protein | - |
| FF959_RS04410 (FF959_04410) | - | 892137..892358 (+) | 222 | WP_001123695.1 | DUF3269 family protein | - |
| FF959_RS04415 (FF959_04415) | - | 892368..892772 (+) | 405 | WP_000049794.1 | DUF1064 domain-containing protein | - |
| FF959_RS04420 (FF959_04420) | - | 892777..892962 (+) | 186 | WP_001187243.1 | DUF3113 family protein | - |
| FF959_RS04425 (FF959_04425) | - | 892963..893268 (+) | 306 | WP_000101252.1 | hypothetical protein | - |
| FF959_RS04430 (FF959_04430) | - | 893396..893752 (+) | 357 | WP_000029376.1 | SA1788 family PVL leukocidin-associated protein | - |
| FF959_RS04435 (FF959_04435) | - | 893756..893998 (+) | 243 | WP_000131376.1 | SAV1978 family virulence-associated passenger protein | - |
| FF959_RS04440 (FF959_04440) | - | 894007..894378 (+) | 372 | WP_001557190.1 | hypothetical protein | - |
| FF959_RS04445 (FF959_04445) | - | 894371..894625 (+) | 255 | WP_001065060.1 | DUF1024 family protein | - |
| FF959_RS04450 (FF959_04450) | - | 894612..894782 (+) | 171 | WP_000714412.1 | hypothetical protein | - |
| FF959_RS04455 (FF959_04455) | - | 894775..895308 (+) | 534 | WP_000185647.1 | dUTP diphosphatase | - |
| FF959_RS04460 (FF959_04460) | - | 895345..895551 (+) | 207 | WP_000617154.1 | DUF1381 domain-containing protein | - |
| FF959_RS04465 (FF959_04465) | - | 895548..895742 (+) | 195 | WP_000132921.1 | hypothetical protein | - |
| FF959_RS04470 (FF959_04470) | - | 895739..895942 (+) | 204 | WP_001072795.1 | hypothetical protein | - |
| FF959_RS04475 (FF959_04475) | - | 895935..896171 (+) | 237 | WP_000608278.1 | hypothetical protein | - |
| FF959_RS04480 (FF959_04480) | - | 896164..896337 (+) | 174 | WP_000595257.1 | transcriptional activator RinB | - |
| FF959_RS04485 (FF959_04485) | - | 896338..896439 (+) | 102 | Protein_851 | hypothetical protein | - |
| FF959_RS04490 (FF959_04490) | - | 896508..896930 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| FF959_RS04495 (FF959_04495) | - | 897118..897612 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| FF959_RS04500 (FF959_04500) | - | 897615..898910 (+) | 1296 | WP_000273011.1 | PBSX family phage terminase large subunit | - |
| FF959_RS04505 (FF959_04505) | - | 898921..900456 (+) | 1536 | WP_001605173.1 | phage portal protein | - |
| FF959_RS04510 (FF959_04510) | - | 900463..901458 (+) | 996 | WP_001133043.1 | minor capsid protein | - |
| FF959_RS04515 (FF959_04515) | - | 901531..901701 (+) | 171 | WP_000072205.1 | hypothetical protein | - |
| FF959_RS14605 | - | 901729..901822 (+) | 94 | Protein_858 | hypothetical protein | - |
| FF959_RS04520 (FF959_04520) | - | 901810..902430 (+) | 621 | WP_000392141.1 | DUF4355 domain-containing protein | - |
| FF959_RS04525 (FF959_04525) | - | 902444..903418 (+) | 975 | WP_000438503.1 | phage major capsid protein | - |
| FF959_RS04530 (FF959_04530) | - | 903440..903727 (+) | 288 | WP_001114086.1 | hypothetical protein | - |
| FF959_RS04535 (FF959_04535) | - | 903736..904068 (+) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| FF959_RS04540 (FF959_04540) | - | 904065..904367 (+) | 303 | WP_001268312.1 | hypothetical protein | - |
| FF959_RS04545 (FF959_04545) | - | 904367..904714 (+) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FF959_RS04550 (FF959_04550) | - | 904726..905109 (+) | 384 | WP_000188643.1 | hypothetical protein | - |
| FF959_RS04555 (FF959_04555) | - | 905128..905709 (+) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| FF959_RS04560 (FF959_04560) | - | 905771..906136 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| FF959_RS04565 (FF959_04565) | - | 906166..906510 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| FF959_RS04570 (FF959_04570) | - | 906527..909991 (+) | 3465 | WP_000141470.1 | hypothetical protein | - |
| FF959_RS04575 (FF959_04575) | - | 910004..910951 (+) | 948 | WP_000350680.1 | phage tail family protein | - |
| FF959_RS04580 (FF959_04580) | - | 910960..912861 (+) | 1902 | WP_000156406.1 | SGNH/GDSL hydrolase family protein | - |
| FF959_RS04585 (FF959_04585) | - | 912876..914786 (+) | 1911 | WP_000369017.1 | hypothetical protein | - |
| FF959_RS04590 (FF959_04590) | - | 914786..916609 (+) | 1824 | WP_000259619.1 | phage baseplate upper protein | - |
| FF959_RS04595 (FF959_04595) | - | 916609..916986 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| FF959_RS04600 (FF959_04600) | - | 916990..917163 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| FF959_RS04605 (FF959_04605) | - | 917203..917502 (+) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| FF959_RS04610 (FF959_04610) | - | 917639..919537 (+) | 1899 | WP_000524022.1 | glucosaminidase domain-containing protein | - |
| FF959_RS04615 (FF959_04615) | - | 919550..920788 (+) | 1239 | WP_000276662.1 | BppU family phage baseplate upper protein | - |
| FF959_RS04620 (FF959_04620) | - | 920794..921189 (+) | 396 | WP_000398868.1 | hypothetical protein | - |
| FF959_RS04625 (FF959_04625) | - | 921245..921520 (+) | 276 | WP_000351119.1 | phage holin | - |
| FF959_RS04630 (FF959_04630) | - | 921507..922919 (+) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| FF959_RS04635 (FF959_04635) | - | 922979..923536 (-) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| FF959_RS04640 (FF959_04640) | - | 923911..924063 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| FF959_RS04645 (FF959_04645) | - | 924134..924244 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| FF959_RS04650 (FF959_04650) | - | 924246..924431 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| FF959_RS04660 (FF959_04660) | - | 925116..925255 (+) | 140 | Protein_886 | hypothetical protein | - |
| FF959_RS04665 (FF959_04665) | - | 925261..925575 (-) | 315 | WP_000274029.1 | hypothetical protein | - |
| FF959_RS04670 (FF959_04670) | - | 925940..926980 (+) | 1041 | WP_000582326.1 | hemolysin family protein | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15872.58 Da Isoelectric Point: 8.4825
>NTDB_id=365896 FF959_RS04380 WP_000934385.1 888811..889239(+) (ssbA) [Staphylococcus aureus strain D592-HR]
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRAVLVGRLTKDPELRSAPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=365896 FF959_RS04380 WP_000934385.1 888811..889239(+) (ssbA) [Staphylococcus aureus strain D592-HR]
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAGCAGTATTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGCGCGCCAAATGGCGTAAATGTAGG
TACATTCACATTGGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAGAAACAAGCTGAAAATGTTAAAAACTACCTTTCTAAAGGGTCGCTGGCAGGTGTAGACGGGCGACTACAAACACGT
AGCTACGAAAATAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.14 |
100 |
0.704 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus mitis SK321 |
39.437 |
100 |
0.394 |