Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | FD735_RS09775 | Genome accession | NZ_CP040231 |
| Coordinates | 1895225..1895350 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799678.1 | Uniprot ID | - |
| Organism | Streptococcus sp. 1643 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1890225..1900350
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FD735_RS09750 (FD735_09750) | - | 1892358..1892900 (+) | 543 | WP_070569601.1 | TetR/AcrR family transcriptional regulator | - |
| FD735_RS09765 (FD735_09765) | comE | 1893136..1893888 (-) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| FD735_RS09770 (FD735_09770) | comD | 1893885..1895204 (-) | 1320 | WP_139659086.1 | competence system sensor histidine kinase ComD | Regulator |
| FD735_RS09775 (FD735_09775) | comC/comC2 | 1895225..1895350 (-) | 126 | WP_000799678.1 | competence-stimulating peptide ComC | Regulator |
| FD735_RS09785 (FD735_09785) | rlmH | 1895632..1896111 (-) | 480 | WP_070569604.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| FD735_RS09790 (FD735_09790) | htrA | 1896297..1897493 (+) | 1197 | WP_070569607.1 | S1C family serine protease | Regulator |
| FD735_RS09795 (FD735_09795) | spo0J | 1897551..1898309 (+) | 759 | WP_139659087.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4960.73 Da Isoelectric Point: 10.3052
>NTDB_id=362680 FD735_RS09775 WP_000799678.1 1895225..1895350(-) (comC/comC2) [Streptococcus sp. 1643]
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=362680 FD735_RS09775 WP_000799678.1 1895225..1895350(-) (comC/comC2) [Streptococcus sp. 1643]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAATCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
56.098 |
100 |
0.561 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |