Detailed information NTG0036167

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GALLO_RS00640
• Genome accession: NC_013798
• Coordinates: 102841..103134 (+)
• Length: 97 a.a.
• NCBI ID: WP_009853231.1
• Uniprot ID: -
• Organism: Streptococcus gallolyticus UCN34
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 97841..108134

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GALLO_RS00625 (GALLO_0086)	-	100494..100862 (+)	369	WP_009853228.1	DUF1033 family protein	-
GALLO_RS00630 (GALLO_0087)	comYA	100933..101874 (+)	942	WP_012961327.1	competence type IV pilus ATPase ComGA	Machinery gene
GALLO_RS00635 (GALLO_0088)	comYB	101756..102841 (+)	1086	WP_012961328.1	competence type IV pilus assembly protein ComGB	Machinery gene
GALLO_RS00640 (GALLO_0089)	comYC	102841..103134 (+)	294	WP_009853231.1	competence type IV pilus major pilin ComGC	Machinery gene
GALLO_RS00645 (GALLO_0090)	comYD	103118..103549 (+)	432	WP_009853232.1	competence type IV pilus minor pilin ComGD	Machinery gene
GALLO_RS00650 (GALLO_0091)	comGE	103503..103796 (+)	294	WP_012961329.1	competence type IV pilus minor pilin ComGE	-
GALLO_RS00655 (GALLO_0092)	comYF	103750..104217 (+)	468	WP_012961330.1	competence type IV pilus minor pilin ComGF	Machinery gene
GALLO_RS00660 (GALLO_0093)	comYG	104189..104503 (+)	315	WP_009853235.1	competence type IV pilus minor pilin ComGG	Machinery gene
GALLO_RS00665 (GALLO_0094)	comYH	104576..105532 (+)	957	WP_009853236.1	class I SAM-dependent methyltransferase	Machinery gene
GALLO_RS00670 (GALLO_0095)	-	105585..106784 (+)	1200	WP_012961331.1	acetate kinase	-
GALLO_RS00675 (GALLO_0096)	-	106946..107146 (+)	201	WP_012961332.1	helix-turn-helix transcriptional regulator	-
GALLO_RS00680 (GALLO_0097)	-	107156..107365 (+)	210	WP_009853239.1	hypothetical protein	-
GALLO_RS00685 (GALLO_0098)	-	107378..107830 (+)	453	WP_009853240.1	hypothetical protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 11042.18 Da
• Isoelectric Point: 9.9310

>NTDB_id=36167 GALLO_RS00640 WP_009853231.1 102841..103134(+) (comYC) [Streptococcus gallolyticus UCN34]
MKKIWKKLRQKTVKGFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYEVKTGDKPTVDDLVE
VGYITSEQAKTYNEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=36167 GALLO_RS00640 WP_009853231.1 102841..103134(+) (comYC) [Streptococcus gallolyticus UCN34]
ATGAAAAAGATTTGGAAAAAATTACGTCAGAAAACGGTAAAAGGGTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT
TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGACGTTGTTCGTGAAAAAGGCGATGCTGCTG
TTGTGAAAGTGGTAGAGAGCCAAATGGATTTGTACGAAGTGAAAACGGGAGATAAACCAACTGTTGATGATTTAGTTGAA
GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	67.391	94.845	0.639
comYC	Streptococcus gordonii str. Challis substr. CH1	64.773	90.722	0.588
comGC/cglC	Streptococcus mitis SK321	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae R6	59.574	96.907	0.577
comGC/cglC	Streptococcus mitis NCTC 12261	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae TIGR4	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae Rx1	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae D39	59.574	96.907	0.577
comYC	Streptococcus mutans UA140	58.427	91.753	0.536
comYC	Streptococcus mutans UA159	58.427	91.753	0.536
comGC	Lactococcus lactis subsp. cremoris KW2	56.667	92.784	0.526