Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SaO82_RS09840 | Genome accession | NZ_CP038819 |
| Coordinates | 1954493..1954918 (-) | Length | 141 a.a. |
| NCBI ID | WP_000934785.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O82 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1917908..1964175 | 1954493..1954918 | within | 0 |
Gene organization within MGE regions
Location: 1917908..1964175
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO82_RS09605 (SaO82_1796) | - | 1919575..1920090 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| SaO82_RS09610 (SaO82_1797) | - | 1920220..1920381 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| SaO82_RS09615 | - | 1920708..1920809 (+) | 102 | WP_101305152.1 | hypothetical protein | - |
| SaO82_RS09620 (SaO82_1798) | - | 1920854..1921855 (-) | 1002 | WP_000593870.1 | restriction endonuclease subunit S | - |
| SaO82_RS14175 | - | 1921839..1923068 (-) | 1230 | WP_247595148.1 | N-6 DNA methylase | - |
| SaO82_RS14180 | - | 1923087..1923731 (-) | 645 | WP_247595149.1 | hypothetical protein | - |
| SaO82_RS09635 (SaO82_1801) | lukF' | 1924241..1925209 (-) | 969 | WP_000669582.1 | bi-component leukocidin LukMF' subunit F' | - |
| SaO82_RS09640 (SaO82_1802) | lukM | 1925211..1926137 (-) | 927 | WP_000476436.1 | bi-component leukocidin LukMF' subunit M | - |
| SaO82_RS09645 (SaO82_1803) | - | 1926485..1927186 (-) | 702 | WP_247595156.1 | CHAP domain-containing protein | - |
| SaO82_RS09650 (SaO82_1804) | - | 1927252..1927506 (-) | 255 | WP_000611513.1 | phage holin | - |
| SaO82_RS09655 | - | 1927558..1927661 (+) | 104 | Protein_1808 | hypothetical protein | - |
| SaO82_RS09660 | - | 1927704..1927811 (-) | 108 | WP_000255427.1 | putative holin-like toxin | - |
| SaO82_RS09665 (SaO82_1805) | - | 1928045..1928341 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SaO82_RS09670 (SaO82_1806) | - | 1928399..1928686 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| SaO82_RS09675 | - | 1928733..1928885 (-) | 153 | WP_001153680.1 | hypothetical protein | - |
| SaO82_RS09680 (SaO82_1807) | - | 1928875..1932660 (-) | 3786 | WP_136142637.1 | phage tail spike protein | - |
| SaO82_RS09685 (SaO82_1808) | - | 1932676..1934166 (-) | 1491 | Protein_1814 | phage tail domain-containing protein | - |
| SaO82_RS09690 (SaO82_1809) | - | 1934166..1938815 (-) | 4650 | WP_136142638.1 | phage tail tape measure protein | - |
| SaO82_RS09695 | - | 1938872..1938994 (-) | 123 | WP_000571956.1 | hypothetical protein | - |
| SaO82_RS09700 (SaO82_1810) | - | 1939054..1939500 (-) | 447 | WP_136142639.1 | hypothetical protein | - |
| SaO82_RS09705 (SaO82_1811) | - | 1939565..1940518 (-) | 954 | WP_000570651.1 | major tail protein | - |
| SaO82_RS09710 (SaO82_1812) | - | 1940519..1940899 (-) | 381 | WP_000611451.1 | hypothetical protein | - |
| SaO82_RS09715 (SaO82_1813) | - | 1940896..1941273 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SaO82_RS09720 (SaO82_1814) | - | 1941273..1941608 (-) | 336 | WP_025174659.1 | head-tail adaptor protein | - |
| SaO82_RS09725 (SaO82_1815) | - | 1941595..1941927 (-) | 333 | WP_001177485.1 | head-tail connector protein | - |
| SaO82_RS09730 (SaO82_1816) | - | 1941936..1942094 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| SaO82_RS09735 (SaO82_1817) | - | 1942130..1943377 (-) | 1248 | WP_000849948.1 | phage major capsid protein | - |
| SaO82_RS09740 (SaO82_1818) | - | 1943465..1944049 (-) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| SaO82_RS09745 (SaO82_1819) | - | 1944042..1945292 (-) | 1251 | WP_000511061.1 | phage portal protein | - |
| SaO82_RS09750 (SaO82_1820) | - | 1945298..1945498 (-) | 201 | WP_000365298.1 | hypothetical protein | - |
| SaO82_RS09755 (SaO82_1821) | - | 1945512..1947206 (-) | 1695 | WP_136142640.1 | phage terminase family protein | - |
| SaO82_RS09760 (SaO82_1822) | - | 1947209..1947676 (-) | 468 | WP_000919023.1 | phage terminase small subunit P27 family | - |
| SaO82_RS09765 (SaO82_1823) | - | 1947805..1948149 (-) | 345 | WP_001803930.1 | HNH endonuclease | - |
| SaO82_RS09770 (SaO82_1824) | - | 1948165..1948617 (-) | 453 | WP_000406189.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SaO82_RS09775 (SaO82_1825) | - | 1948732..1949193 (-) | 462 | WP_000282752.1 | hypothetical protein | - |
| SaO82_RS09780 (SaO82_1826) | - | 1949216..1949416 (-) | 201 | WP_000265040.1 | DUF1514 family protein | - |
| SaO82_RS09785 (SaO82_1827) | - | 1949416..1950066 (-) | 651 | WP_001005261.1 | hypothetical protein | - |
| SaO82_RS09790 (SaO82_1828) | - | 1950225..1950374 (-) | 150 | WP_000595250.1 | transcriptional activator RinB | - |
| SaO82_RS09795 (SaO82_1829) | - | 1950371..1950577 (-) | 207 | WP_000195765.1 | DUF1381 domain-containing protein | - |
| SaO82_RS09800 (SaO82_1830) | - | 1950614..1951126 (-) | 513 | WP_136142641.1 | dUTPase | - |
| SaO82_RS09805 (SaO82_1831) | - | 1951119..1951361 (-) | 243 | WP_136142642.1 | hypothetical protein | - |
| SaO82_RS09810 (SaO82_1832) | - | 1951361..1951603 (-) | 243 | WP_136142643.1 | DUF1024 family protein | - |
| SaO82_RS09815 (SaO82_1833) | - | 1951596..1951886 (-) | 291 | WP_001804359.1 | hypothetical protein | - |
| SaO82_RS09820 (SaO82_1834) | - | 1951895..1952137 (-) | 243 | WP_000131362.1 | SAV1978 family virulence-associated passenger protein | - |
| SaO82_RS09825 (SaO82_1835) | - | 1952212..1952976 (-) | 765 | Protein_1842 | ATP-binding protein | - |
| SaO82_RS09830 (SaO82_1836) | - | 1952989..1953812 (-) | 824 | Protein_1843 | phage replisome organizer N-terminal domain-containing protein | - |
| SaO82_RS09835 (SaO82_1837) | - | 1953784..1954479 (-) | 696 | WP_001121801.1 | putative HNHc nuclease | - |
| SaO82_RS09840 (SaO82_1838) | ssbA | 1954493..1954918 (-) | 426 | WP_000934785.1 | single-stranded DNA-binding protein | Machinery gene |
| SaO82_RS09845 (SaO82_1839) | - | 1954918..1955556 (-) | 639 | WP_001043063.1 | ERF family protein | - |
| SaO82_RS09850 (SaO82_1840) | - | 1955556..1956035 (-) | 480 | WP_000002514.1 | siphovirus Gp157 family protein | - |
| SaO82_RS09855 (SaO82_1841) | - | 1956050..1956310 (-) | 261 | WP_000291086.1 | DUF1108 family protein | - |
| SaO82_RS09860 (SaO82_1842) | - | 1956405..1956566 (-) | 162 | WP_000048119.1 | DUF1270 family protein | - |
| SaO82_RS09865 (SaO82_1843) | - | 1956559..1956780 (-) | 222 | WP_000594788.1 | hypothetical protein | - |
| SaO82_RS09870 (SaO82_1844) | - | 1956851..1957063 (+) | 213 | WP_000461464.1 | hypothetical protein | - |
| SaO82_RS14185 | - | 1957078..1957155 (-) | 78 | Protein_1852 | hypothetical protein | - |
| SaO82_RS09875 (SaO82_1845) | - | 1957171..1957920 (-) | 750 | WP_065316555.1 | phage antirepressor KilAC domain-containing protein | - |
| SaO82_RS09880 (SaO82_1846) | - | 1957981..1958223 (+) | 243 | WP_000498529.1 | hypothetical protein | - |
| SaO82_RS09885 | - | 1958171..1958479 (-) | 309 | WP_001025399.1 | hypothetical protein | - |
| SaO82_RS09890 (SaO82_1847) | - | 1958495..1958764 (-) | 270 | WP_000854067.1 | helix-turn-helix transcriptional regulator | - |
| SaO82_RS09895 | - | 1958783..1958935 (-) | 153 | Protein_1857 | transcriptional regulator | - |
| SaO82_RS09900 (SaO82_1848) | - | 1958898..1959611 (+) | 714 | WP_001031451.1 | XRE family transcriptional regulator | - |
| SaO82_RS14010 (SaO82_1849) | - | 1959623..1959769 (+) | 147 | WP_001049401.1 | hypothetical protein | - |
| SaO82_RS09905 (SaO82_1850) | - | 1959766..1959951 (+) | 186 | WP_000100503.1 | hypothetical protein | - |
| SaO82_RS09910 (SaO82_1851) | - | 1959987..1960970 (+) | 984 | WP_136142645.1 | DUF3644 domain-containing protein | - |
| SaO82_RS09915 (SaO82_1852) | - | 1961149..1962195 (+) | 1047 | WP_001145719.1 | tyrosine-type recombinase/integrase | - |
| SaO82_RS09920 (SaO82_1853) | yfkAB | 1962240..1963385 (+) | 1146 | WP_136142646.1 | radical SAM/CxCxxxxC motif protein YfkAB | - |
| SaO82_RS09925 (SaO82_1854) | - | 1963645..1964175 (-) | 531 | WP_000184381.1 | acyl-CoA thioesterase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15949.37 Da Isoelectric Point: 4.6952
>NTDB_id=355820 SaO82_RS09840 WP_000934785.1 1954493..1954918(-) (ssbA) [Staphylococcus aureus strain O82]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYQQQGQTQTGNNPFDNTEEDFSDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQQNNNYQQQGQTQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=355820 SaO82_RS09840 WP_000934785.1 1954493..1954918(-) (ssbA) [Staphylococcus aureus strain O82]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCAACAACAAGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAG
AAGACTTTTCTGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAACAACAATTATCAACAACAAGGACAAACTCAAACTGGTAATAATCCGTTCGACAATACCGAAG
AAGACTTTTCTGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
81.308 |
75.887 |
0.617 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.263 |
100 |
0.596 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
47.826 |
81.56 |
0.39 |
| ssbA | Streptococcus mutans UA159 |
46.957 |
81.56 |
0.383 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.688 |
0.376 |