Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SAAV_RS04300 | Genome accession | NC_013450 |
| Coordinates | 863279..863704 (+) | Length | 141 a.a. |
| NCBI ID | WP_000934795.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus subsp. aureus ED98 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 855889..896138 | 863279..863704 | within | 0 |
Gene organization within MGE regions
Location: 855889..896138
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAAV_RS04225 | - | 856541..856726 (-) | 186 | WP_031794897.1 | hypothetical protein | - |
| SAAV_RS04230 (SAAV_0822) | - | 856882..857598 (-) | 717 | WP_001083976.1 | LexA family transcriptional regulator | - |
| SAAV_RS04235 (SAAV_0823) | - | 857762..858004 (+) | 243 | WP_000639926.1 | DUF739 family protein | - |
| SAAV_RS04240 (SAAV_0824) | - | 858017..858460 (+) | 444 | WP_000435347.1 | hypothetical protein | - |
| SAAV_RS04245 (SAAV_0825) | - | 858475..858618 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| SAAV_RS04250 (SAAV_0826) | - | 858628..859230 (-) | 603 | WP_012840514.1 | hypothetical protein | - |
| SAAV_RS04255 | - | 859673..859858 (+) | 186 | WP_000933364.1 | helix-turn-helix transcriptional regulator | - |
| SAAV_RS04260 (SAAV_0827) | - | 859860..860612 (+) | 753 | WP_001148607.1 | phage antirepressor KilAC domain-containing protein | - |
| SAAV_RS04265 (SAAV_0828) | - | 860653..860943 (+) | 291 | WP_000405222.1 | hypothetical protein | - |
| SAAV_RS15400 (SAAV_0829) | - | 860955..861125 (-) | 171 | WP_000224747.1 | hypothetical protein | - |
| SAAV_RS04270 (SAAV_0830) | - | 861196..861417 (+) | 222 | WP_000594794.1 | hypothetical protein | - |
| SAAV_RS04275 | - | 861410..861571 (+) | 162 | WP_000048127.1 | DUF1270 family protein | - |
| SAAV_RS04280 (SAAV_0831) | - | 861665..861925 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| SAAV_RS04285 (SAAV_0832) | - | 861933..862169 (+) | 237 | WP_000802315.1 | hypothetical protein | - |
| SAAV_RS04290 (SAAV_0833) | - | 862162..862641 (+) | 480 | WP_000002513.1 | siphovirus Gp157 family protein | - |
| SAAV_RS04295 (SAAV_0834) | - | 862641..863279 (+) | 639 | WP_001043061.1 | ERF family protein | - |
| SAAV_RS04300 (SAAV_0835) | ssbA | 863279..863704 (+) | 426 | WP_000934795.1 | single-stranded DNA-binding protein | Machinery gene |
| SAAV_RS04305 | - | 863718..864392 (+) | 675 | WP_001124442.1 | putative HNHc nuclease | - |
| SAAV_RS04310 (SAAV_0837) | - | 864502..865161 (-) | 660 | WP_016028252.1 | hypothetical protein | - |
| SAAV_RS04315 (SAAV_0838) | - | 865207..865977 (+) | 771 | WP_000190226.1 | conserved phage C-terminal domain-containing protein | - |
| SAAV_RS04320 (SAAV_0839) | - | 865987..866760 (+) | 774 | WP_000803029.1 | ATP-binding protein | - |
| SAAV_RS04325 (SAAV_0840) | - | 866754..866912 (+) | 159 | WP_000256595.1 | hypothetical protein | - |
| SAAV_RS04330 | - | 866925..867146 (+) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| SAAV_RS04335 (SAAV_0841) | - | 867156..867563 (+) | 408 | Protein_832 | RusA family crossover junction endodeoxyribonuclease | - |
| SAAV_RS04340 (SAAV_0842) | - | 867563..867748 (+) | 186 | WP_001187267.1 | DUF3113 family protein | - |
| SAAV_RS04345 (SAAV_0843) | - | 867749..868108 (+) | 360 | WP_000117793.1 | SA1788 family PVL leukocidin-associated protein | - |
| SAAV_RS04350 | - | 868109..868357 (+) | 249 | WP_000920572.1 | phi PVL orf 51-like protein | - |
| SAAV_RS04355 (SAAV_0844) | - | 868372..868620 (+) | 249 | WP_001065055.1 | DUF1024 family protein | - |
| SAAV_RS04360 (SAAV_0845) | - | 868613..869146 (+) | 534 | WP_000185661.1 | dUTP pyrophosphatase | - |
| SAAV_RS04365 (SAAV_0846) | - | 869183..869428 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| SAAV_RS04370 (SAAV_0847) | - | 869425..869631 (+) | 207 | WP_000195771.1 | DUF1381 domain-containing protein | - |
| SAAV_RS04375 (SAAV_0848) | - | 869628..870014 (+) | 387 | WP_000592220.1 | hypothetical protein | - |
| SAAV_RS04380 | - | 870011..870160 (+) | 150 | WP_000595305.1 | transcriptional activator RinB | - |
| SAAV_RS04385 (SAAV_0849) | - | 870319..870969 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| SAAV_RS04390 (SAAV_0850) | - | 870969..871169 (+) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| SAAV_RS04400 (SAAV_0851) | - | 871192..871662 (+) | 471 | WP_000282758.1 | hypothetical protein | - |
| SAAV_RS04405 (SAAV_0852) | - | 871777..872229 (+) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SAAV_RS04410 (SAAV_0853) | - | 872245..872589 (+) | 345 | WP_000817289.1 | HNH endonuclease | - |
| SAAV_RS04415 (SAAV_0854) | - | 872717..873187 (+) | 471 | WP_000919024.1 | phage terminase small subunit P27 family | - |
| SAAV_RS04420 (SAAV_0855) | - | 873187..874881 (+) | 1695 | WP_000568450.1 | phage terminase family protein | - |
| SAAV_RS04430 (SAAV_0857) | - | 875101..876351 (+) | 1251 | WP_000511073.1 | phage portal protein | - |
| SAAV_RS04435 (SAAV_0858) | - | 876344..876928 (+) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| SAAV_RS04440 (SAAV_0859) | - | 877016..878263 (+) | 1248 | WP_000849958.1 | phage major capsid protein | - |
| SAAV_RS04445 (SAAV_0860) | - | 878299..878457 (+) | 159 | WP_001252099.1 | hypothetical protein | - |
| SAAV_RS04450 (SAAV_0861) | - | 878466..878798 (+) | 333 | WP_001177489.1 | head-tail connector protein | - |
| SAAV_RS04455 | - | 878785..879120 (+) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| SAAV_RS04460 (SAAV_0862) | - | 879120..879497 (+) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SAAV_RS04465 (SAAV_0863) | - | 879494..879874 (+) | 381 | WP_000611449.1 | hypothetical protein | - |
| SAAV_RS04470 (SAAV_0864) | - | 879875..880828 (+) | 954 | WP_000570652.1 | major tail protein | - |
| SAAV_RS04475 (SAAV_0865) | - | 880893..881339 (+) | 447 | WP_000442601.1 | hypothetical protein | - |
| SAAV_RS04480 (SAAV_0866) | - | 881399..881521 (+) | 123 | WP_000571956.1 | hypothetical protein | - |
| SAAV_RS04485 (SAAV_0867) | - | 881577..886226 (+) | 4650 | WP_001133536.1 | phage tail tape measure protein | - |
| SAAV_RS04490 (SAAV_0868) | - | 886226..887716 (+) | 1491 | WP_001154317.1 | phage tail domain-containing protein | - |
| SAAV_RS04495 (SAAV_0869) | - | 887732..891514 (+) | 3783 | WP_000582132.1 | phage tail spike protein | - |
| SAAV_RS04500 (SAAV_0870) | - | 891507..891659 (+) | 153 | WP_001000058.1 | hypothetical protein | - |
| SAAV_RS04505 (SAAV_0871) | - | 891705..891992 (+) | 288 | WP_001262623.1 | hypothetical protein | - |
| SAAV_RS04510 (SAAV_0872) | - | 892048..892422 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| SAAV_RS14780 | pepG1 | 892607..892741 (+) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SAAV_RS04520 | - | 892794..892901 (-) | 108 | WP_031762631.1 | hypothetical protein | - |
| SAAV_RS04525 (SAAV_0873) | - | 892952..893227 (+) | 276 | WP_000351119.1 | phage holin | - |
| SAAV_RS04530 (SAAV_0874) | - | 893214..894626 (+) | 1413 | WP_001141512.1 | N-acetylmuramoyl-L-alanine amidase | - |
| SAAV_RS04535 (SAAV_0875) | - | 894686..895243 (-) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| SAAV_RS04540 (SAAV_0876) | - | 895618..895770 (+) | 153 | WP_001788502.1 | hypothetical protein | - |
| SAAV_RS04545 (SAAV_0877) | - | 895841..895951 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| SAAV_RS04550 (SAAV_0878) | - | 895953..896138 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 16000.67 Da Isoelectric Point: 6.3912
>NTDB_id=35579 SAAV_RS04300 WP_000934795.1 863279..863704(+) (ssbA) [Staphylococcus aureus subsp. aureus ED98]
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQQKNNYQQQRQTQTGNNPFDNTEEDFSDLPF
MLNRVVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
NYENKDGQRVFVTEVVADSVQFLEPKNNNQQQKNNYQQQRQTQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=35579 SAAV_RS04300 WP_000934795.1 863279..863704(+) (ssbA) [Staphylococcus aureus subsp. aureus ED98]
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGTACACCAAATGGTGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTACAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAAAAACAATTATCAACAACAAAGACAAACTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
ATGTTAAACAGAGTAGTTTTAGTAGGACGCTTAACAAAAGACCCAGAATTAAGAAGTACACCAAATGGTGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTCACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAACTACCTTTCTAAAGGATCGTTGGCAGGTGTAGACGGACGACTACAAACACGT
AACTACGAAAACAAAGACGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTACAATTCTTAGAACCGAAGAA
TAACAACCAACAACAAAAAAACAATTATCAACAACAAAGACAAACTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
83.178 |
75.887 |
0.631 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.579 |
100 |
0.61 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
75.177 |
0.447 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.565 |
81.56 |
0.404 |
| ssbA | Streptococcus mutans UA159 |
48.696 |
81.56 |
0.397 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.61 |
83.688 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.61 |
83.688 |
0.39 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.763 |
83.688 |
0.383 |