Detailed information NTG0355546

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: E5Z44_RS09600
• Genome accession: NZ_CP038807
• Coordinates: 2060154..2060468 (-)
• Length: 104 a.a.
• NCBI ID: WP_002459016.1
• Uniprot ID: -
• Organism: Staphylococcus lugdunensis strain APC 3758
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2055154..2065468

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E5Z44_RS09565 (E5Z44_09700)	gcvPA	2055727..2057076 (-)	1350	WP_002478134.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
E5Z44_RS09570 (E5Z44_09705)	gcvT	2057093..2058184 (-)	1092	WP_037540763.1	glycine cleavage system aminomethyltransferase GcvT	-
E5Z44_RS09575 (E5Z44_09710)	-	2058354..2058872 (-)	519	WP_002459021.1	shikimate kinase	-
E5Z44_RS09585 (E5Z44_09720)	-	2059026..2059484 (-)	459	WP_311201967.1	competence type IV pilus minor pilin ComGF	-
E5Z44_RS09590 (E5Z44_09725)	-	2059447..2059740 (-)	294	WP_002459018.1	hypothetical protein	-
E5Z44_RS09595 (E5Z44_09730)	comGD	2059727..2060221 (-)	495	WP_225306455.1	competence type IV pilus minor pilin ComGD	-
E5Z44_RS09600 (E5Z44_09735)	comGC	2060154..2060468 (-)	315	WP_002459016.1	competence type IV pilus major pilin ComGC	Machinery gene
E5Z44_RS09605 (E5Z44_09740)	comGB	2060483..2061547 (-)	1065	WP_002478130.1	competence type IV pilus assembly protein ComGB	-
E5Z44_RS09610 (E5Z44_09745)	comGA	2061519..2062493 (-)	975	WP_002491905.1	competence type IV pilus ATPase ComGA	Machinery gene
E5Z44_RS09615 (E5Z44_09750)	-	2062540..2063163 (-)	624	WP_002459013.1	MBL fold metallo-hydrolase	-
E5Z44_RS09620 (E5Z44_09755)	-	2063167..2063490 (-)	324	WP_002459012.1	MTH1187 family thiamine-binding protein	-
E5Z44_RS09625 (E5Z44_09760)	-	2063490..2064476 (-)	987	WP_002491907.1	ROK family glucokinase	-
E5Z44_RS09630 (E5Z44_09765)	-	2064473..2064676 (-)	204	WP_002459010.1	YqgQ family protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11373.37 Da
• Isoelectric Point: 8.2727

>NTDB_id=355546 E5Z44_RS09600 WP_002459016.1 2060154..2060468(-) (comGC) [Staphylococcus lugdunensis strain APC 3758]
MKFSFYKKCKAFTLIEMLLVLLIISVLLILIIPNIAKQTAHVQSTGCEAQVKMVNSQIEAYTLKHNGSPKSIDDLISEGF
IKDGQKNCKSGETISISNGEAVAN

Nucleotide

• Length: 315 bp

>NTDB_id=355546 E5Z44_RS09600 WP_002459016.1 2060154..2060468(-) (comGC) [Staphylococcus lugdunensis strain APC 3758]
ATGAAATTTTCTTTTTATAAAAAATGCAAAGCGTTTACACTAATAGAAATGTTATTAGTATTACTAATTATTAGTGTCTT
GCTTATCTTAATTATTCCAAACATTGCCAAACAAACAGCACATGTACAATCAACAGGTTGTGAAGCACAAGTAAAGATGG
TCAATAGCCAAATAGAAGCCTATACTCTAAAGCATAATGGATCTCCAAAAAGCATTGATGATTTAATTTCTGAGGGTTTT
ATTAAAGATGGTCAAAAGAATTGCAAATCTGGGGAAACCATCAGCATATCAAATGGTGAGGCAGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	82.353	98.077	0.808
comGC	Staphylococcus aureus N315	82.353	98.077	0.808
comYC	Streptococcus gordonii str. Challis substr. CH1	45.918	94.231	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	44.554	97.115	0.433
comGC	Bacillus subtilis subsp. subtilis str. 168	46.154	87.5	0.404
comGC/cglC	Streptococcus pneumoniae R6	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae Rx1	48.235	81.731	0.394
comGC/cglC	Streptococcus pneumoniae D39	48.235	81.731	0.394
comGC	Lactococcus lactis subsp. cremoris KW2	50.633	75.962	0.385
comGC/cglC	Streptococcus mitis SK321	51.282	75	0.385
comGC/cglC	Streptococcus mitis NCTC 12261	51.282	75	0.385
comYC	Streptococcus mutans UA140	48.75	76.923	0.375
comYC	Streptococcus mutans UA159	48.75	76.923	0.375