Detailed information
Bioinformatically predicted
Overview
| Name | ssbB/cilA | Type | Machinery gene |
| Locus tag | ES298_RS09075 | Genome accession | NZ_CP038253 |
| Coordinates | 1778178..1778558 (-) | Length | 126 a.a. |
| NCBI ID | WP_033621334.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1901929 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1776100..1837975 | 1778178..1778558 | within | 0 |
Gene organization within MGE regions
Location: 1776100..1837975
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ES298_RS09065 (ES298_09575) | groL | 1776100..1777722 (-) | 1623 | WP_000031573.1 | chaperonin GroEL | - |
| ES298_RS09070 (ES298_09580) | groES | 1777738..1778022 (-) | 285 | WP_000917299.1 | co-chaperone GroES | - |
| ES298_RS09075 (ES298_09585) | ssbB/cilA | 1778178..1778558 (-) | 381 | WP_033621334.1 | single-stranded DNA-binding protein | Machinery gene |
| ES298_RS09080 (ES298_09590) | - | 1778582..1778824 (-) | 243 | WP_000698517.1 | hypothetical protein | - |
| ES298_RS09085 (ES298_09595) | lytA | 1779056..1780012 (-) | 957 | WP_000350534.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| ES298_RS09090 (ES298_09600) | - | 1780018..1780347 (-) | 330 | WP_001186214.1 | phage holin | - |
| ES298_RS09095 (ES298_09605) | - | 1780351..1780650 (-) | 300 | WP_001810279.1 | hypothetical protein | - |
| ES298_RS09100 (ES298_09610) | - | 1780660..1781010 (-) | 351 | WP_054393306.1 | hypothetical protein | - |
| ES298_RS09105 (ES298_09615) | - | 1781013..1781216 (-) | 204 | WP_001091110.1 | hypothetical protein | - |
| ES298_RS11325 (ES298_09620) | - | 1781197..1781313 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| ES298_RS09110 | - | 1781310..1788848 (-) | 7539 | WP_409202203.1 | tail fiber domain-containing protein | - |
| ES298_RS09115 (ES298_09635) | - | 1788889..1789239 (-) | 351 | WP_000068023.1 | DUF6711 family protein | - |
| ES298_RS09120 (ES298_09640) | - | 1789248..1792862 (-) | 3615 | WP_061642927.1 | hypothetical protein | - |
| ES298_RS09125 (ES298_09645) | - | 1792849..1793199 (-) | 351 | WP_000478007.1 | hypothetical protein | - |
| ES298_RS09130 (ES298_09650) | - | 1793238..1793618 (-) | 381 | WP_001185631.1 | DUF6096 family protein | - |
| ES298_RS09135 (ES298_09655) | - | 1793623..1794036 (-) | 414 | WP_000880665.1 | phage tail tube protein | - |
| ES298_RS09140 (ES298_09660) | - | 1794039..1794407 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| ES298_RS09145 (ES298_09665) | - | 1794404..1794919 (-) | 516 | WP_000015940.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ES298_RS09150 (ES298_09670) | - | 1794894..1795232 (-) | 339 | WP_000478943.1 | hypothetical protein | - |
| ES298_RS09155 (ES298_09675) | - | 1795213..1795524 (-) | 312 | WP_000021218.1 | phage head-tail connector protein | - |
| ES298_RS09160 (ES298_09680) | - | 1795526..1795714 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| ES298_RS09165 (ES298_09685) | - | 1795724..1796749 (-) | 1026 | WP_000863393.1 | carbohydrate-binding protein | - |
| ES298_RS09170 (ES298_09690) | - | 1796772..1797296 (-) | 525 | WP_001288018.1 | DUF4355 domain-containing protein | - |
| ES298_RS09175 | - | 1797563..1797736 (-) | 174 | WP_000356388.1 | hypothetical protein | - |
| ES298_RS09180 (ES298_09695) | - | 1797778..1798191 (-) | 414 | WP_000565273.1 | HD domain-containing protein | - |
| ES298_RS09185 (ES298_09700) | - | 1798188..1798397 (-) | 210 | WP_000651747.1 | hypothetical protein | - |
| ES298_RS09190 (ES298_09705) | - | 1798399..1800036 (-) | 1638 | WP_178387375.1 | minor capsid protein | - |
| ES298_RS09195 (ES298_09710) | - | 1799945..1801414 (-) | 1470 | WP_075275088.1 | phage portal protein | - |
| ES298_RS09200 (ES298_09715) | - | 1801426..1802724 (-) | 1299 | WP_061389546.1 | PBSX family phage terminase large subunit | - |
| ES298_RS09205 (ES298_09720) | - | 1802702..1803202 (-) | 501 | WP_001155235.1 | terminase small subunit | - |
| ES298_RS09215 (ES298_09725) | - | 1803610..1804014 (-) | 405 | WP_001030241.1 | DUF1492 domain-containing protein | - |
| ES298_RS09220 (ES298_09730) | - | 1804087..1804458 (-) | 372 | WP_001247150.1 | hypothetical protein | - |
| ES298_RS09225 (ES298_09735) | - | 1804455..1804892 (-) | 438 | WP_000188937.1 | YopX family protein | - |
| ES298_RS09230 (ES298_09740) | - | 1804904..1805326 (-) | 423 | WP_000140868.1 | hypothetical protein | - |
| ES298_RS09235 (ES298_09745) | - | 1805323..1805583 (-) | 261 | WP_000819329.1 | DUF1372 family protein | - |
| ES298_RS11210 | - | 1805580..1805702 (-) | 123 | WP_001842508.1 | hypothetical protein | - |
| ES298_RS09240 (ES298_09750) | - | 1805741..1806229 (-) | 489 | WP_001041151.1 | DUF1642 domain-containing protein | - |
| ES298_RS09245 (ES298_09755) | - | 1806231..1806548 (-) | 318 | WP_000969676.1 | hypothetical protein | - |
| ES298_RS09250 (ES298_09760) | - | 1806573..1806755 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| ES298_RS09255 (ES298_09765) | - | 1806771..1807202 (-) | 432 | WP_000779141.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ES298_RS09260 (ES298_09770) | - | 1807199..1807528 (-) | 330 | WP_000157070.1 | hypothetical protein | - |
| ES298_RS09265 (ES298_09775) | - | 1807542..1807751 (-) | 210 | WP_000455270.1 | hypothetical protein | - |
| ES298_RS09270 (ES298_09780) | - | 1807753..1808448 (-) | 696 | WP_000401828.1 | site-specific DNA-methyltransferase | - |
| ES298_RS09275 (ES298_09785) | ssbA | 1808461..1808877 (-) | 417 | WP_000609559.1 | single-stranded DNA-binding protein | Machinery gene |
| ES298_RS09280 (ES298_09790) | - | 1808972..1809307 (-) | 336 | WP_000598345.1 | sporulation protein Cse60 | - |
| ES298_RS09285 (ES298_09795) | - | 1809300..1809623 (-) | 324 | WP_000354630.1 | hypothetical protein | - |
| ES298_RS09290 (ES298_09800) | - | 1809601..1810689 (-) | 1089 | WP_001157029.1 | DUF1351 domain-containing protein | - |
| ES298_RS09295 (ES298_09805) | bet | 1810699..1811517 (-) | 819 | WP_000184004.1 | phage recombination protein Bet | - |
| ES298_RS09300 (ES298_09810) | - | 1811787..1812047 (-) | 261 | WP_000471459.1 | hypothetical protein | - |
| ES298_RS09305 (ES298_09815) | - | 1812060..1812314 (-) | 255 | WP_000275523.1 | hypothetical protein | - |
| ES298_RS09310 (ES298_09820) | - | 1812315..1812536 (-) | 222 | WP_000771950.1 | hypothetical protein | - |
| ES298_RS09315 | - | 1812536..1812673 (-) | 138 | WP_000869368.1 | hypothetical protein | - |
| ES298_RS09320 (ES298_09825) | - | 1812691..1813488 (-) | 798 | WP_001056933.1 | ParB N-terminal domain-containing protein | - |
| ES298_RS09325 | - | 1813555..1813698 (-) | 144 | WP_000389589.1 | hypothetical protein | - |
| ES298_RS09330 (ES298_09830) | - | 1813817..1814008 (+) | 192 | WP_000834563.1 | hypothetical protein | - |
| ES298_RS09335 (ES298_09840) | - | 1814418..1814738 (-) | 321 | WP_223687705.1 | HTH domain-containing protein | - |
| ES298_RS09340 (ES298_09845) | - | 1814823..1815050 (-) | 228 | WP_001125554.1 | helix-turn-helix transcriptional regulator | - |
| ES298_RS09345 (ES298_09850) | - | 1815123..1815329 (+) | 207 | WP_000133214.1 | hypothetical protein | - |
| ES298_RS09350 | - | 1815554..1815724 (-) | 171 | WP_000660185.1 | hypothetical protein | - |
| ES298_RS09355 (ES298_09860) | - | 1815923..1816372 (+) | 450 | WP_001058908.1 | hypothetical protein | - |
| ES298_RS09360 | - | 1816363..1816530 (-) | 168 | WP_001005822.1 | hypothetical protein | - |
| ES298_RS09365 (ES298_09865) | - | 1816605..1816880 (-) | 276 | WP_001094375.1 | hypothetical protein | - |
| ES298_RS09370 (ES298_09870) | - | 1817053..1817844 (+) | 792 | WP_000090699.1 | XRE family transcriptional regulator | - |
| ES298_RS09375 (ES298_09875) | - | 1817846..1818046 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| ES298_RS09380 (ES298_09880) | - | 1818214..1819641 (+) | 1428 | WP_000859012.1 | recombinase family protein | - |
| ES298_RS09385 (ES298_09885) | - | 1819777..1820538 (-) | 762 | WP_001107758.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| ES298_RS09390 (ES298_09890) | ytpR | 1820580..1821206 (-) | 627 | WP_000578289.1 | YtpR family tRNA-binding protein | - |
| ES298_RS09395 (ES298_09895) | - | 1821222..1821539 (-) | 318 | WP_000615769.1 | thioredoxin family protein | - |
| ES298_RS09400 (ES298_09900) | - | 1821536..1821835 (-) | 300 | WP_001013974.1 | DUF4651 domain-containing protein | - |
| ES298_RS09405 | - | 1822033..1822095 (-) | 63 | WP_219335288.1 | hypothetical protein | - |
| ES298_RS09410 (ES298_09910) | - | 1822120..1822311 (-) | 192 | WP_000291826.1 | cell wall-binding protein | - |
| ES298_RS09415 (ES298_09915) | - | 1822472..1823146 (-) | 675 | WP_000725750.1 | LiaF transmembrane domain-containing protein | - |
| ES298_RS09420 (ES298_09920) | - | 1823152..1823598 (-) | 447 | WP_000776589.1 | LytTR family DNA-binding domain-containing protein | - |
| ES298_RS09425 (ES298_09925) | - | 1823712..1824215 (-) | 504 | WP_000800942.1 | phosphatase PAP2 family protein | - |
| ES298_RS09430 (ES298_09930) | - | 1824212..1824574 (-) | 363 | WP_000078805.1 | DUF2200 domain-containing protein | - |
| ES298_RS09435 | rcrQ | 1824640..1825671 (-) | 1032 | WP_000506424.1 | ABC transporter ATP-binding protein | Regulator |
| ES298_RS09440 | rcrP | 1825678..1826499 (-) | 822 | WP_000601682.1 | ABC transporter permease | Regulator |
| ES298_RS09445 (ES298_09940) | - | 1826515..1826985 (-) | 471 | WP_000517879.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| ES298_RS09450 (ES298_09950) | - | 1827109..1827825 (-) | 717 | WP_000532876.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| ES298_RS09455 (ES298_09960) | ply | 1828706..1830121 (-) | 1416 | WP_001284363.1 | cholesterol-dependent cytolysin pneumolysin | - |
| ES298_RS09460 (ES298_09965) | - | 1830132..1830542 (-) | 411 | WP_000595757.1 | hypothetical protein | - |
| ES298_RS09465 (ES298_09970) | - | 1830535..1831143 (-) | 609 | WP_000083614.1 | hypothetical protein | - |
| ES298_RS09470 (ES298_09975) | - | 1831156..1831614 (-) | 459 | WP_000186955.1 | DUF4231 domain-containing protein | - |
| ES298_RS09475 (ES298_09980) | - | 1831848..1832138 (+) | 291 | Protein_1877 | transposase family protein | - |
| ES298_RS09480 (ES298_09985) | - | 1832640..1833500 (+) | 861 | WP_001810270.1 | glycerophosphodiester phosphodiesterase family protein | - |
| ES298_RS09485 (ES298_09990) | - | 1833484..1834545 (+) | 1062 | WP_000475761.1 | extracellular solute-binding protein | - |
| ES298_RS09490 (ES298_09995) | - | 1834562..1835566 (+) | 1005 | WP_000627599.1 | ABC transporter ATP-binding protein | - |
| ES298_RS09495 (ES298_10000) | - | 1835578..1837272 (+) | 1695 | WP_001232286.1 | iron ABC transporter permease | - |
| ES298_RS09500 (ES298_10005) | - | 1837274..1837975 (+) | 702 | WP_001054457.1 | MgtC/SapB family protein | - |
Sequence
Protein
Download Length: 126 a.a. Molecular weight: 14318.16 Da Isoelectric Point: 5.2813
>NTDB_id=352719 ES298_RS09075 WP_033621334.1 1778178..1778558(-) (ssbB/cilA) [Streptococcus pneumoniae strain TVO_1901929]
MLIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREVDFVNMVLWGRLAETLASYATKGSLISVDGELRTRRFEKN
GQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
MLIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREVDFVNMVLWGRLAETLASYATKGSLISVDGELRTRRFEKN
GQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
Nucleotide
Download Length: 381 bp
>NTDB_id=352719 ES298_RS09075 WP_033621334.1 1778178..1778558(-) (ssbB/cilA) [Streptococcus pneumoniae strain TVO_1901929]
ATCTTGATTGGACGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCAGTAGCGCGAGCAACTATCGC
TGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGTTGATTTTGTCAATATGGTCCTATGGGGCAGACTAGCAG
AAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGTCGCTTTGAGAAAAAT
GGTCAGATGAATTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTGGAAAGTCGTGCCCAACGTGCTATGCGTGA
AAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA
ATCTTGATTGGACGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCAGTAGCGCGAGCAACTATCGC
TGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGTTGATTTTGTCAATATGGTCCTATGGGGCAGACTAGCAG
AAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGTCGCTTTGAGAAAAAT
GGTCAGATGAATTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTGGAAAGTCGTGCCCAACGTGCTATGCGTGA
AAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
98.413 |
100 |
0.984 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
97.619 |
100 |
0.976 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
97.619 |
100 |
0.976 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
97.619 |
100 |
0.976 |
| ssbB/cilA | Streptococcus mitis SK321 |
97.619 |
100 |
0.976 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
96.032 |
100 |
0.96 |
| ssbA | Streptococcus mutans UA159 |
73.016 |
100 |
0.73 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
68.254 |
100 |
0.683 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
60.55 |
86.508 |
0.524 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.495 |
80.159 |
0.405 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.296 |
85.714 |
0.397 |