Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SaO267_RS10715 | Genome accession | NZ_CP034102 |
| Coordinates | 2037759..2038184 (-) | Length | 141 a.a. |
| NCBI ID | WP_000934786.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O267 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1999211..2047050 | 2037759..2038184 | within | 0 |
Gene organization within MGE regions
Location: 1999211..2047050
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO267_RS10400 (SaO267_01915) | - | 2000920..2001435 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| SaO267_RS10405 (SaO267_01916) | - | 2001565..2001726 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| SaO267_RS15315 | - | 2001950..2002078 (+) | 129 | WP_277600192.1 | hypothetical protein | - |
| SaO267_RS10410 | - | 2002161..2002241 (-) | 81 | WP_100250272.1 | hypothetical protein | - |
| SaO267_RS10415 | - | 2002313..2002471 (+) | 159 | Protein_1946 | IS3 family transposase | - |
| SaO267_RS10420 (SaO267_01917) | - | 2002640..2003155 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| SaO267_RS10425 (SaO267_01918) | - | 2003285..2003446 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| SaO267_RS10435 | - | 2003911..2003991 (+) | 81 | WP_100250272.1 | hypothetical protein | - |
| SaO267_RS10440 (SaO267_01919) | - | 2004074..2004472 (-) | 399 | WP_000557464.1 | hypothetical protein | - |
| SaO267_RS10445 (SaO267_01920) | - | 2004462..2004989 (-) | 528 | WP_000455173.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| SaO267_RS10450 (SaO267_01921) | - | 2005011..2005190 (-) | 180 | WP_000201919.1 | hypothetical protein | - |
| SaO267_RS10460 (SaO267_01922) | lukF' | 2005790..2006758 (-) | 969 | WP_000669582.1 | bi-component leukocidin LukMF' subunit F' | - |
| SaO267_RS10465 (SaO267_01923) | lukM | 2006760..2007686 (-) | 927 | WP_000476436.1 | bi-component leukocidin LukMF' subunit M | - |
| SaO267_RS10470 (SaO267_01924) | - | 2008034..2008789 (-) | 756 | WP_000861033.1 | CHAP domain-containing protein | - |
| SaO267_RS10475 (SaO267_01925) | - | 2008801..2009055 (-) | 255 | WP_000611513.1 | phage holin | - |
| SaO267_RS10480 | - | 2009107..2009210 (+) | 104 | Protein_1957 | hypothetical protein | - |
| SaO267_RS10485 | - | 2009253..2009360 (-) | 108 | WP_000255427.1 | putative holin-like toxin | - |
| SaO267_RS10490 (SaO267_01926) | - | 2009594..2009890 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SaO267_RS10495 (SaO267_01927) | - | 2009948..2010235 (-) | 288 | WP_001040260.1 | hypothetical protein | - |
| SaO267_RS10500 (SaO267_01928) | - | 2010282..2010434 (-) | 153 | WP_001153680.1 | hypothetical protein | - |
| SaO267_RS10505 (SaO267_01929) | - | 2010424..2014209 (-) | 3786 | WP_126117007.1 | phage tail spike protein | - |
| SaO267_RS10510 (SaO267_01930) | - | 2014225..2015715 (-) | 1491 | WP_043039559.1 | phage tail domain-containing protein | - |
| SaO267_RS10515 (SaO267_01931) | - | 2015715..2020364 (-) | 4650 | WP_043039556.1 | phage tail tape measure protein | - |
| SaO267_RS10520 (SaO267_01932) | - | 2020421..2020543 (-) | 123 | WP_000571956.1 | hypothetical protein | - |
| SaO267_RS10525 (SaO267_01933) | - | 2020603..2021049 (-) | 447 | WP_000442601.1 | hypothetical protein | - |
| SaO267_RS10530 (SaO267_01934) | - | 2021114..2022067 (-) | 954 | WP_000570651.1 | major tail protein | - |
| SaO267_RS10535 (SaO267_01935) | - | 2022068..2022448 (-) | 381 | WP_000611451.1 | hypothetical protein | - |
| SaO267_RS10540 (SaO267_01936) | - | 2022445..2022822 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SaO267_RS10545 (SaO267_01937) | - | 2022822..2023157 (-) | 336 | WP_025174659.1 | head-tail adaptor protein | - |
| SaO267_RS10550 (SaO267_01938) | - | 2023144..2023476 (-) | 333 | WP_001177485.1 | head-tail connector protein | - |
| SaO267_RS10555 (SaO267_01939) | - | 2023485..2023643 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| SaO267_RS10560 (SaO267_01940) | - | 2023679..2024926 (-) | 1248 | WP_000849947.1 | phage major capsid protein | - |
| SaO267_RS10565 (SaO267_01941) | - | 2025014..2025598 (-) | 585 | WP_000032525.1 | HK97 family phage prohead protease | - |
| SaO267_RS10570 (SaO267_01942) | - | 2025591..2026841 (-) | 1251 | WP_000511072.1 | phage portal protein | - |
| SaO267_RS10580 (SaO267_01943) | - | 2027061..2028755 (-) | 1695 | WP_000568452.1 | phage terminase family protein | - |
| SaO267_RS10585 (SaO267_01944) | - | 2028755..2029225 (-) | 471 | WP_000919024.1 | phage terminase small subunit P27 family | - |
| SaO267_RS10590 (SaO267_01945) | - | 2029354..2029698 (-) | 345 | WP_001803930.1 | HNH endonuclease | - |
| SaO267_RS10595 (SaO267_01946) | - | 2029714..2030166 (-) | 453 | WP_000406189.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SaO267_RS10600 (SaO267_01947) | - | 2030281..2030742 (-) | 462 | WP_000282752.1 | hypothetical protein | - |
| SaO267_RS10610 (SaO267_01948) | - | 2030765..2030965 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| SaO267_RS10615 (SaO267_01949) | - | 2030965..2031114 (-) | 150 | WP_000595242.1 | transcriptional activator RinB | - |
| SaO267_RS10620 (SaO267_01950) | - | 2031111..2031317 (-) | 207 | WP_000195824.1 | DUF1381 domain-containing protein | - |
| SaO267_RS10625 (SaO267_01951) | - | 2031317..2031514 (-) | 198 | WP_000037315.1 | hypothetical protein | - |
| SaO267_RS10630 (SaO267_01952) | - | 2031511..2031753 (-) | 243 | WP_000028779.1 | hypothetical protein | - |
| SaO267_RS10635 (SaO267_01953) | - | 2031790..2032302 (-) | 513 | WP_000181820.1 | dUTP pyrophosphatase | - |
| SaO267_RS10640 (SaO267_01954) | - | 2032295..2032543 (-) | 249 | WP_001065117.1 | DUF1024 family protein | - |
| SaO267_RS10645 (SaO267_01955) | - | 2032536..2032811 (-) | 276 | WP_126116993.1 | hypothetical protein | - |
| SaO267_RS10650 (SaO267_01956) | - | 2032811..2033221 (-) | 411 | WP_000695751.1 | DUF4388 domain-containing protein | - |
| SaO267_RS15240 | - | 2033218..2033418 (-) | 201 | WP_241228712.1 | hypothetical protein | - |
| SaO267_RS10660 (SaO267_01957) | - | 2033478..2033720 (-) | 243 | WP_065315858.1 | phi PVL orf 51-like protein | - |
| SaO267_RS10665 (SaO267_01958) | - | 2033724..2034092 (-) | 369 | WP_126117042.1 | SA1788 family PVL leukocidin-associated protein | - |
| SaO267_RS10670 (SaO267_01959) | - | 2034093..2034278 (-) | 186 | WP_001187254.1 | DUF3113 family protein | - |
| SaO267_RS10675 (SaO267_01960) | - | 2034283..2034687 (-) | 405 | WP_126117043.1 | DUF1064 domain-containing protein | - |
| SaO267_RS10680 (SaO267_01961) | - | 2034680..2034919 (-) | 240 | WP_126117044.1 | DUF3269 family protein | - |
| SaO267_RS10685 (SaO267_01962) | - | 2034922..2035137 (-) | 216 | WP_001024402.1 | hypothetical protein | - |
| SaO267_RS10690 (SaO267_01963) | - | 2035134..2036375 (-) | 1242 | WP_126117045.1 | DnaB helicase C-terminal domain-containing protein | - |
| SaO267_RS10695 (SaO267_01964) | - | 2036372..2036728 (-) | 357 | WP_001132243.1 | hypothetical protein | - |
| SaO267_RS15120 | - | 2036765..2037029 (-) | 265 | Protein_1999 | phage replisome organizer N-terminal domain-containing protein | - |
| SaO267_RS10710 (SaO267_01965) | - | 2037011..2037745 (-) | 735 | WP_241228713.1 | putative HNHc nuclease | - |
| SaO267_RS10715 (SaO267_01966) | ssbA | 2037759..2038184 (-) | 426 | WP_000934786.1 | single-stranded DNA-binding protein | Machinery gene |
| SaO267_RS10720 (SaO267_01967) | - | 2038184..2038822 (-) | 639 | WP_001043063.1 | ERF family protein | - |
| SaO267_RS10725 (SaO267_01968) | - | 2038822..2039301 (-) | 480 | WP_000002514.1 | siphovirus Gp157 family protein | - |
| SaO267_RS10730 (SaO267_01969) | - | 2039294..2039530 (-) | 237 | WP_000802315.1 | hypothetical protein | - |
| SaO267_RS10735 (SaO267_01970) | - | 2039538..2039798 (-) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| SaO267_RS10740 (SaO267_01971) | - | 2039892..2040212 (-) | 321 | WP_000219666.1 | hypothetical protein | - |
| SaO267_RS10745 (SaO267_01972) | - | 2040213..2040380 (-) | 168 | WP_031889410.1 | DUF1270 domain-containing protein | - |
| SaO267_RS15045 (SaO267_01973) | - | 2040373..2040510 (-) | 138 | WP_164528209.1 | hypothetical protein | - |
| SaO267_RS10750 (SaO267_01974) | - | 2040614..2040817 (-) | 204 | Protein_2009 | hypothetical protein | - |
| SaO267_RS10755 (SaO267_01975) | - | 2040830..2041543 (-) | 714 | WP_001157024.1 | phage repressor protein | - |
| SaO267_RS10760 (SaO267_01976) | - | 2041600..2041809 (+) | 210 | WP_000772137.1 | hypothetical protein | - |
| SaO267_RS10765 (SaO267_01977) | - | 2041802..2041942 (-) | 141 | WP_000939495.1 | hypothetical protein | - |
| SaO267_RS10770 (SaO267_01978) | - | 2041957..2042403 (-) | 447 | WP_000435348.1 | hypothetical protein | - |
| SaO267_RS10775 (SaO267_01979) | - | 2042416..2042658 (-) | 243 | WP_000639923.1 | DUF739 family protein | - |
| SaO267_RS10780 (SaO267_01980) | - | 2042822..2043538 (+) | 717 | WP_001083975.1 | LexA family transcriptional regulator | - |
| SaO267_RS10785 (SaO267_01981) | - | 2043550..2044404 (+) | 855 | WP_000804506.1 | HIRAN domain-containing protein | - |
| SaO267_RS15050 (SaO267_01982) | - | 2044478..2044624 (+) | 147 | WP_000345949.1 | hypothetical protein | - |
| SaO267_RS10790 (SaO267_01983) | - | 2044621..2044806 (+) | 186 | WP_000100503.1 | hypothetical protein | - |
| SaO267_RS10795 (SaO267_01984) | - | 2044842..2045825 (+) | 984 | WP_000439125.1 | DUF3644 domain-containing protein | - |
| SaO267_RS10800 (SaO267_01985) | - | 2046004..2047050 (+) | 1047 | WP_001145720.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15877.35 Da Isoelectric Point: 4.6952
>NTDB_id=329020 SaO267_RS10715 WP_000934786.1 2037759..2038184(-) (ssbA) [Staphylococcus aureus strain O267]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNSNQQQNDNYQQQGQAQTGNNPFDNTEEDFSDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=329020 SaO267_RS10715 WP_000934786.1 2037759..2038184(-) (ssbA) [Staphylococcus aureus strain O267]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTGTTTGTTACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAGCAACCAACAACAAAATGACAATTATCAACAACAAGGACAAGCTCAAACTGGTAATAATCCGTTTGACAATACTGAAG
AAGATTTTTCAGACCTCCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
81.308 |
75.887 |
0.617 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.947 |
100 |
0.582 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.087 |
81.56 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.068 |
83.688 |
0.369 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.068 |
83.688 |
0.369 |
| ssbA | Streptococcus mutans UA159 |
45.217 |
81.56 |
0.369 |