Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO326_RS07890 | Genome accession | NZ_CP032481 |
| Coordinates | 1583948..1584259 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O326 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1578948..1589259
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO326_RS07855 (SaO326_01431) | gcvPA | 1579450..1580796 (-) | 1347 | WP_000019686.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO326_RS07860 (SaO326_01432) | gcvT | 1580816..1581907 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO326_RS07865 (SaO326_01433) | - | 1582066..1582590 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SaO326_RS07870 | - | 1582580..1582726 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO326_RS07875 (SaO326_01434) | comGF | 1582823..1583320 (-) | 498 | WP_029656266.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO326_RS07880 (SaO326_01435) | comGE | 1583238..1583537 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SaO326_RS07885 (SaO326_01436) | comGD | 1583524..1583970 (-) | 447 | WP_001791207.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO326_RS07890 (SaO326_01437) | comGC | 1583948..1584259 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO326_RS07895 (SaO326_01438) | comGB | 1584273..1585343 (-) | 1071 | WP_000776417.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO326_RS07900 (SaO326_01439) | comGA | 1585315..1586289 (-) | 975 | WP_000697233.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO326_RS07905 (SaO326_01440) | - | 1586341..1586964 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO326_RS07910 | - | 1586961..1587290 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO326_RS07915 (SaO326_01441) | - | 1587290..1588276 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| SaO326_RS07920 | - | 1588273..1588476 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=316346 SaO326_RS07890 WP_000472256.1 1583948..1584259(-) (comGC) [Staphylococcus aureus strain O326]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=316346 SaO326_RS07890 WP_000472256.1 1583948..1584259(-) (comGC) [Staphylococcus aureus strain O326]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |