Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SaO17_RS09975 | Genome accession | NZ_CP032051 |
| Coordinates | 1948278..1948706 (-) | Length | 142 a.a. |
| NCBI ID | WP_118848134.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O17 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1910053..1956829 | 1948278..1948706 | within | 0 |
Gene organization within MGE regions
Location: 1910053..1956829
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO17_RS09710 (SaO17_01796) | - | 1911761..1912276 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| SaO17_RS09715 (SaO17_01797) | - | 1912406..1912567 (-) | 162 | WP_001005407.1 | SE1561 family protein | - |
| SaO17_RS09720 | - | 1912894..1912995 (+) | 102 | WP_101305152.1 | hypothetical protein | - |
| SaO17_RS09725 (SaO17_01798) | - | 1913040..1914041 (-) | 1002 | WP_000593870.1 | restriction endonuclease subunit S | - |
| SaO17_RS09730 (SaO17_01799) | - | 1914025..1915917 (-) | 1893 | WP_001003361.1 | N-6 DNA methylase | - |
| SaO17_RS09740 (SaO17_01800) | lukF' | 1916429..1917397 (-) | 969 | WP_000669582.1 | bi-component leukocidin LukMF' subunit F' | - |
| SaO17_RS09745 (SaO17_01801) | lukM | 1917399..1918325 (-) | 927 | WP_000476436.1 | bi-component leukocidin LukMF' subunit M | - |
| SaO17_RS09750 (SaO17_01802) | - | 1918673..1919428 (-) | 756 | WP_000861033.1 | CHAP domain-containing protein | - |
| SaO17_RS09755 (SaO17_01803) | - | 1919440..1919694 (-) | 255 | WP_000611513.1 | phage holin | - |
| SaO17_RS09760 | - | 1919746..1919849 (+) | 104 | Protein_1814 | hypothetical protein | - |
| SaO17_RS09765 | - | 1919892..1919999 (-) | 108 | WP_000255427.1 | putative holin-like toxin | - |
| SaO17_RS09770 (SaO17_01804) | - | 1920233..1920529 (-) | 297 | WP_065315589.1 | DUF2951 domain-containing protein | - |
| SaO17_RS09775 (SaO17_01805) | - | 1920587..1920874 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| SaO17_RS09780 (SaO17_01806) | - | 1920921..1921073 (-) | 153 | WP_001153680.1 | hypothetical protein | - |
| SaO17_RS09785 (SaO17_01807) | - | 1921063..1924848 (-) | 3786 | WP_118848128.1 | phage tail spike protein | - |
| SaO17_RS09790 (SaO17_01808) | - | 1924864..1926354 (-) | 1491 | WP_118848129.1 | phage tail domain-containing protein | - |
| SaO17_RS09795 (SaO17_01809) | - | 1926354..1931003 (-) | 4650 | WP_118848130.1 | phage tail tape measure protein | - |
| SaO17_RS09800 | - | 1931059..1931181 (-) | 123 | WP_000571956.1 | hypothetical protein | - |
| SaO17_RS09805 (SaO17_01810) | - | 1931241..1931687 (-) | 447 | WP_000442600.1 | hypothetical protein | - |
| SaO17_RS09810 (SaO17_01811) | - | 1931752..1932705 (-) | 954 | WP_065315587.1 | major tail protein | - |
| SaO17_RS09815 | - | 1932706..1933086 (-) | 381 | WP_000611452.1 | hypothetical protein | - |
| SaO17_RS09820 (SaO17_01812) | - | 1933083..1933460 (-) | 378 | WP_000501246.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SaO17_RS09825 (SaO17_01813) | - | 1933460..1933795 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| SaO17_RS09830 (SaO17_01814) | - | 1933782..1934114 (-) | 333 | WP_065315586.1 | head-tail connector protein | - |
| SaO17_RS09835 (SaO17_01815) | - | 1934123..1934281 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| SaO17_RS09840 (SaO17_01816) | - | 1934317..1935564 (-) | 1248 | WP_043039550.1 | phage major capsid protein | - |
| SaO17_RS09845 (SaO17_01817) | - | 1935652..1936236 (-) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| SaO17_RS09850 (SaO17_01818) | - | 1936229..1937479 (-) | 1251 | WP_000511061.1 | phage portal protein | - |
| SaO17_RS09855 (SaO17_01819) | - | 1937485..1937685 (-) | 201 | WP_000365298.1 | hypothetical protein | - |
| SaO17_RS09860 (SaO17_01820) | - | 1937699..1939393 (-) | 1695 | WP_065316526.1 | phage terminase family protein | - |
| SaO17_RS09865 (SaO17_01821) | - | 1939396..1939863 (-) | 468 | WP_065315584.1 | phage terminase small subunit P27 family | - |
| SaO17_RS09870 (SaO17_01822) | - | 1939992..1940336 (-) | 345 | WP_001803930.1 | HNH endonuclease | - |
| SaO17_RS09875 (SaO17_01823) | - | 1940352..1940804 (-) | 453 | WP_000406189.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SaO17_RS09880 (SaO17_01824) | - | 1940919..1941380 (-) | 462 | WP_118848131.1 | hypothetical protein | - |
| SaO17_RS09885 (SaO17_01825) | - | 1941403..1941603 (-) | 201 | WP_000265040.1 | DUF1514 family protein | - |
| SaO17_RS09890 (SaO17_01826) | - | 1941603..1942253 (-) | 651 | WP_001005261.1 | hypothetical protein | - |
| SaO17_RS09895 (SaO17_01827) | - | 1942412..1942561 (-) | 150 | WP_000595250.1 | transcriptional activator RinB | - |
| SaO17_RS09900 (SaO17_01828) | - | 1942558..1942764 (-) | 207 | WP_000195770.1 | DUF1381 domain-containing protein | - |
| SaO17_RS14365 | - | 1942801..1942899 (-) | 99 | Protein_1843 | dUTP diphosphatase | - |
| SaO17_RS09910 (SaO17_01830) | - | 1943135..1943383 (-) | 249 | WP_001065080.1 | DUF1024 family protein | - |
| SaO17_RS09915 | - | 1943376..1943652 (-) | 277 | Protein_1845 | hypothetical protein | - |
| SaO17_RS09920 (SaO17_01831) | - | 1943652..1944062 (-) | 411 | WP_000695750.1 | hypothetical protein | - |
| SaO17_RS14450 | - | 1944059..1944259 (-) | 201 | WP_240328063.1 | hypothetical protein | - |
| SaO17_RS09930 (SaO17_01832) | - | 1944319..1944567 (-) | 249 | WP_118848177.1 | SAV1978 family virulence-associated passenger protein | - |
| SaO17_RS14455 | - | 1944567..1944638 (-) | 72 | Protein_1849 | hypothetical protein | - |
| SaO17_RS09935 | - | 1944644..1944784 (-) | 141 | Protein_1850 | SA1788 family PVL leukocidin-associated protein | - |
| SaO17_RS09940 (SaO17_01833) | - | 1944897..1945082 (-) | 186 | WP_015977922.1 | DUF3113 family protein | - |
| SaO17_RS09945 (SaO17_01834) | - | 1945087..1945491 (-) | 405 | WP_000049813.1 | DUF1064 domain-containing protein | - |
| SaO17_RS09950 (SaO17_01835) | - | 1945502..1945723 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| SaO17_RS09955 (SaO17_01836) | - | 1945726..1945941 (-) | 216 | WP_118848132.1 | hypothetical protein | - |
| SaO17_RS09960 (SaO17_01837) | - | 1945938..1947126 (-) | 1189 | Protein_1855 | DnaB-like helicase C-terminal domain-containing protein | - |
| SaO17_RS09965 (SaO17_01838) | - | 1947123..1947479 (-) | 357 | WP_015977669.1 | hypothetical protein | - |
| SaO17_RS09970 (SaO17_01839) | - | 1947586..1948266 (-) | 681 | WP_118848133.1 | putative HNHc nuclease | - |
| SaO17_RS09975 (SaO17_01840) | ssbA | 1948278..1948706 (-) | 429 | WP_118848134.1 | single-stranded DNA-binding protein | Machinery gene |
| SaO17_RS09980 (SaO17_01841) | - | 1948706..1949344 (-) | 639 | WP_001043063.1 | ERF family protein | - |
| SaO17_RS09985 (SaO17_01842) | - | 1949344..1949823 (-) | 480 | WP_000002517.1 | siphovirus Gp157 family protein | - |
| SaO17_RS09990 (SaO17_01843) | - | 1949838..1950099 (-) | 262 | Protein_1861 | DUF1108 family protein | - |
| SaO17_RS09995 (SaO17_01844) | - | 1950194..1950355 (-) | 162 | WP_065315819.1 | DUF1270 domain-containing protein | - |
| SaO17_RS10000 (SaO17_01845) | - | 1950339..1950569 (-) | 231 | WP_065315818.1 | hypothetical protein | - |
| SaO17_RS10005 (SaO17_01846) | - | 1950640..1950852 (+) | 213 | WP_000461464.1 | hypothetical protein | - |
| SaO17_RS14460 | - | 1950867..1950944 (-) | 78 | Protein_1865 | hypothetical protein | - |
| SaO17_RS10010 (SaO17_01847) | - | 1950960..1951709 (-) | 750 | WP_065316555.1 | phage antirepressor KilAC domain-containing protein | - |
| SaO17_RS10020 (SaO17_01848) | - | 1951960..1952247 (-) | 288 | WP_065316727.1 | hypothetical protein | - |
| SaO17_RS10025 (SaO17_01849) | - | 1952302..1952511 (+) | 210 | WP_000772137.1 | hypothetical protein | - |
| SaO17_RS10030 (SaO17_01850) | - | 1952504..1952644 (-) | 141 | WP_000939495.1 | hypothetical protein | - |
| SaO17_RS10035 (SaO17_01851) | - | 1952659..1953102 (-) | 444 | WP_065316411.1 | hypothetical protein | - |
| SaO17_RS10040 (SaO17_01852) | - | 1953150..1953362 (-) | 213 | WP_118848135.1 | helix-turn-helix transcriptional regulator | - |
| SaO17_RS10045 (SaO17_01853) | - | 1953514..1954245 (+) | 732 | WP_065315845.1 | XRE family transcriptional regulator | - |
| SaO17_RS14290 (SaO17_01854) | - | 1954257..1954403 (+) | 147 | WP_001049401.1 | hypothetical protein | - |
| SaO17_RS10050 (SaO17_01855) | - | 1954400..1954585 (+) | 186 | WP_065315846.1 | hypothetical protein | - |
| SaO17_RS10055 (SaO17_01856) | - | 1954621..1955604 (+) | 984 | WP_000439124.1 | DUF3644 domain-containing protein | - |
| SaO17_RS10060 (SaO17_01857) | - | 1955783..1956829 (+) | 1047 | WP_065315847.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 16019.60 Da Isoelectric Point: 6.9799
>NTDB_id=313380 SaO17_RS09975 WP_118848134.1 1948278..1948706(-) (ssbA) [Staphylococcus aureus strain O17]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKVGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=313380 SaO17_RS09975 WP_118848134.1 1948278..1948706(-) (ssbA) [Staphylococcus aureus strain O17]
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCGAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGTCGGGCAACGTGTATTTGTGACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
58.721 |
100 |
0.711 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.613 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.958 |
100 |
0.423 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.141 |
100 |
0.401 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.141 |
100 |
0.401 |