Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO17_RS07745 | Genome accession | NZ_CP032051 |
| Coordinates | 1554489..1554800 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O17 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1549489..1559800
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO17_RS07710 (SaO17_01431) | gcvPA | 1549992..1551338 (-) | 1347 | WP_000019697.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO17_RS07715 (SaO17_01432) | gcvT | 1551358..1552449 (-) | 1092 | WP_000093343.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO17_RS07720 (SaO17_01433) | - | 1552607..1553131 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SaO17_RS07725 | - | 1553121..1553267 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO17_RS07730 (SaO17_01434) | comGF | 1553364..1553861 (-) | 498 | WP_078061106.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO17_RS07735 | comGE | 1553779..1554078 (-) | 300 | WP_000844409.1 | hypothetical protein | Machinery gene |
| SaO17_RS07740 (SaO17_01435) | comGD | 1554065..1554511 (-) | 447 | WP_118848117.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO17_RS07745 (SaO17_01436) | comGC | 1554489..1554800 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO17_RS07750 (SaO17_01437) | comGB | 1554814..1555884 (-) | 1071 | WP_000776418.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO17_RS07755 (SaO17_01438) | comGA | 1555856..1556830 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO17_RS07760 (SaO17_01439) | - | 1556882..1557505 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO17_RS07765 | - | 1557502..1557831 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO17_RS07770 (SaO17_01440) | - | 1557831..1558817 (-) | 987 | WP_118848118.1 | ROK family glucokinase | - |
| SaO17_RS07775 (SaO17_01441) | - | 1558814..1559017 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=313367 SaO17_RS07745 WP_000472256.1 1554489..1554800(-) (comGC) [Staphylococcus aureus strain O17]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=313367 SaO17_RS07745 WP_000472256.1 1554489..1554800(-) (comGC) [Staphylococcus aureus strain O17]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |