Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DRC71_RS12685 | Genome accession | NZ_CP031605 |
| Coordinates | 2635845..2636258 (-) | Length | 137 a.a. |
| NCBI ID | WP_189695506.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain VB16 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2600410..2643051 | 2635845..2636258 | within | 0 |
Gene organization within MGE regions
Location: 2600410..2643051
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DRC71_RS12435 (DRC71_12550) | - | 2600410..2601798 (-) | 1389 | WP_189695472.1 | N-acetylmuramoyl-L-alanine amidase | - |
| DRC71_RS12440 (DRC71_12555) | - | 2601811..2602116 (-) | 306 | WP_189695473.1 | phage holin | - |
| DRC71_RS12445 (DRC71_12560) | - | 2602164..2603624 (-) | 1461 | WP_189695474.1 | BppU family phage baseplate upper protein | - |
| DRC71_RS12450 (DRC71_12565) | - | 2603633..2605519 (-) | 1887 | WP_189695600.1 | glucosaminidase domain-containing protein | - |
| DRC71_RS12455 (DRC71_12570) | - | 2605647..2605946 (-) | 300 | WP_265477336.1 | DUF2951 family protein | - |
| DRC71_RS12460 (DRC71_12575) | - | 2605984..2606133 (-) | 150 | WP_189695476.1 | XkdX family protein | - |
| DRC71_RS12465 (DRC71_12580) | - | 2606135..2606545 (-) | 411 | WP_189695477.1 | hypothetical protein | - |
| DRC71_RS12470 (DRC71_12585) | - | 2606558..2608048 (-) | 1491 | WP_189695478.1 | BppU family phage baseplate upper protein | - |
| DRC71_RS12475 (DRC71_12590) | - | 2608048..2610705 (-) | 2658 | WP_189695479.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| DRC71_RS12480 (DRC71_12595) | - | 2610708..2612210 (-) | 1503 | WP_189695480.1 | phage tail protein | - |
| DRC71_RS12485 (DRC71_12600) | - | 2612219..2613133 (-) | 915 | WP_189695481.1 | phage tail domain-containing protein | - |
| DRC71_RS12490 (DRC71_12605) | - | 2613151..2616144 (-) | 2994 | WP_189695482.1 | terminase | - |
| DRC71_RS12495 (DRC71_12610) | - | 2616147..2616428 (-) | 282 | WP_189695483.1 | hypothetical protein | - |
| DRC71_RS12500 (DRC71_12615) | - | 2616497..2616994 (-) | 498 | WP_189695484.1 | tail assembly chaperone | - |
| DRC71_RS12505 (DRC71_12620) | - | 2617055..2617630 (-) | 576 | WP_189695485.1 | phage tail protein | - |
| DRC71_RS12510 (DRC71_12625) | - | 2617635..2618057 (-) | 423 | WP_189695486.1 | DUF3168 domain-containing protein | - |
| DRC71_RS12515 (DRC71_12630) | - | 2618068..2618481 (-) | 414 | WP_189695487.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DRC71_RS12520 (DRC71_12635) | - | 2618468..2618803 (-) | 336 | WP_189695488.1 | phage head closure protein | - |
| DRC71_RS12525 (DRC71_12640) | - | 2618805..2619101 (-) | 297 | WP_019167201.1 | phage head-tail connector protein | - |
| DRC71_RS12530 (DRC71_12645) | - | 2619101..2619385 (-) | 285 | WP_189695489.1 | Rho termination factor N-terminal domain-containing protein | - |
| DRC71_RS12535 (DRC71_12650) | - | 2619402..2620238 (-) | 837 | WP_189695490.1 | N4-gp56 family major capsid protein | - |
| DRC71_RS12540 (DRC71_12655) | - | 2620259..2620852 (-) | 594 | WP_189695491.1 | phage scaffolding protein | - |
| DRC71_RS12545 (DRC71_12665) | - | 2621145..2622098 (-) | 954 | WP_189695492.1 | phage minor head protein | - |
| DRC71_RS12550 (DRC71_12670) | - | 2622067..2623485 (-) | 1419 | WP_189695493.1 | phage portal protein | - |
| DRC71_RS12555 (DRC71_12675) | - | 2623486..2624751 (-) | 1266 | WP_189695494.1 | PBSX family phage terminase large subunit | - |
| DRC71_RS12560 (DRC71_12680) | - | 2624735..2625223 (-) | 489 | WP_065354587.1 | terminase small subunit | - |
| DRC71_RS12565 (DRC71_12685) | - | 2625521..2625940 (-) | 420 | WP_065354588.1 | transcriptional regulator | - |
| DRC71_RS12570 | - | 2625943..2626095 (-) | 153 | WP_179292371.1 | hypothetical protein | - |
| DRC71_RS12575 (DRC71_12690) | rinB | 2626095..2626265 (-) | 171 | WP_096533881.1 | transcriptional activator RinB | - |
| DRC71_RS12580 (DRC71_12695) | - | 2626280..2626468 (-) | 189 | WP_189695495.1 | DUF1381 domain-containing protein | - |
| DRC71_RS12585 (DRC71_12700) | - | 2626639..2627169 (-) | 531 | WP_189695496.1 | dUTPase | - |
| DRC71_RS12590 | - | 2627162..2627317 (-) | 156 | WP_189695497.1 | hypothetical protein | - |
| DRC71_RS12595 (DRC71_12705) | - | 2627318..2627584 (-) | 267 | WP_189695498.1 | hypothetical protein | - |
| DRC71_RS12600 | - | 2627608..2627769 (-) | 162 | WP_015728819.1 | hypothetical protein | - |
| DRC71_RS12605 | - | 2627770..2627925 (-) | 156 | WP_179292373.1 | hypothetical protein | - |
| DRC71_RS12610 (DRC71_12710) | - | 2627926..2628105 (-) | 180 | WP_096533886.1 | hypothetical protein | - |
| DRC71_RS14045 (DRC71_12715) | - | 2628106..2628486 (-) | 381 | WP_242442481.1 | hypothetical protein | - |
| DRC71_RS12620 (DRC71_12720) | - | 2628486..2628737 (-) | 252 | WP_189695499.1 | hypothetical protein | - |
| DRC71_RS12625 (DRC71_12725) | - | 2628734..2629657 (-) | 924 | WP_409327408.1 | DNA cytosine methyltransferase | - |
| DRC71_RS12630 (DRC71_12730) | - | 2629676..2630200 (-) | 525 | WP_110149719.1 | HNH endonuclease | - |
| DRC71_RS12635 (DRC71_12735) | - | 2630207..2630458 (-) | 252 | WP_189695500.1 | SAV1978 family virulence-associated passenger protein | - |
| DRC71_RS12640 (DRC71_12740) | - | 2630459..2630911 (-) | 453 | WP_189695501.1 | DUF3310 domain-containing protein | - |
| DRC71_RS12645 (DRC71_12745) | - | 2631072..2631392 (-) | 321 | WP_189695502.1 | hypothetical protein | - |
| DRC71_RS12650 (DRC71_12750) | - | 2631405..2631623 (-) | 219 | WP_096533165.1 | hypothetical protein | - |
| DRC71_RS12655 (DRC71_12755) | - | 2631607..2632047 (-) | 441 | WP_189695503.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DRC71_RS12660 (DRC71_12765) | - | 2632249..2633496 (-) | 1248 | WP_375794029.1 | DnaB helicase C-terminal domain-containing protein | - |
| DRC71_RS12665 (DRC71_12770) | - | 2633486..2633827 (-) | 342 | WP_037543633.1 | hypothetical protein | - |
| DRC71_RS12670 (DRC71_12775) | - | 2633824..2634609 (-) | 786 | WP_189695504.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DRC71_RS12675 (DRC71_12780) | - | 2634609..2635280 (-) | 672 | WP_189695505.1 | putative HNHc nuclease | - |
| DRC71_RS12680 (DRC71_12785) | - | 2635281..2635832 (-) | 552 | WP_099989996.1 | NUMOD4 motif-containing HNH endonuclease | - |
| DRC71_RS12685 (DRC71_12790) | ssbA | 2635845..2636258 (-) | 414 | WP_189695506.1 | single-stranded DNA-binding protein | Machinery gene |
| DRC71_RS12690 (DRC71_12795) | - | 2636258..2636881 (-) | 624 | WP_189695507.1 | ERF family protein | - |
| DRC71_RS12695 (DRC71_12800) | - | 2636885..2637433 (-) | 549 | WP_189695508.1 | host-nuclease inhibitor Gam family protein | - |
| DRC71_RS12700 (DRC71_12805) | - | 2637450..2637632 (-) | 183 | WP_189695509.1 | hypothetical protein | - |
| DRC71_RS12705 (DRC71_12810) | - | 2637644..2637904 (-) | 261 | WP_189695510.1 | DUF1108 family protein | - |
| DRC71_RS12710 (DRC71_12815) | - | 2637993..2638172 (-) | 180 | WP_189695602.1 | hypothetical protein | - |
| DRC71_RS14300 (DRC71_12820) | - | 2638183..2638230 (-) | 48 | Protein_2510 | hypothetical protein | - |
| DRC71_RS12720 (DRC71_12825) | - | 2638279..2638992 (-) | 714 | WP_265477337.1 | BRO family protein | - |
| DRC71_RS12725 (DRC71_12830) | - | 2639023..2639466 (-) | 444 | WP_065354605.1 | hypothetical protein | - |
| DRC71_RS12730 (DRC71_12835) | - | 2639479..2639718 (-) | 240 | WP_019165844.1 | helix-turn-helix transcriptional regulator | - |
| DRC71_RS12735 (DRC71_12840) | - | 2639889..2640587 (+) | 699 | WP_096536624.1 | S24 family peptidase | - |
| DRC71_RS12740 | - | 2640599..2640766 (+) | 168 | WP_019165842.1 | hypothetical protein | - |
| DRC71_RS12745 (DRC71_12845) | - | 2640779..2641609 (+) | 831 | WP_189695511.1 | DUF5067 domain-containing protein | - |
| DRC71_RS12750 (DRC71_12850) | - | 2641666..2643051 (+) | 1386 | WP_189695512.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 15602.20 Da Isoelectric Point: 6.3425
>NTDB_id=307877 DRC71_RS12685 WP_189695506.1 2635845..2636258(-) (ssbA) [Staphylococcus pseudintermedius strain VB16]
MLNRVVLIGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKSNGQSNSQAKQQQRQDNPFDNSDFDDSSLPF
MLNRVVLIGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKSNGQSNSQAKQQQRQDNPFDNSDFDDSSLPF
Nucleotide
Download Length: 414 bp
>NTDB_id=307877 DRC71_RS12685 WP_189695506.1 2635845..2636258(-) (ssbA) [Staphylococcus pseudintermedius strain VB16]
ATGCTTAACAGAGTCGTATTAATAGGTCGATTAACAAAAGACCCTGAATTCAGAACAACGCAATCAGGCGTTGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATCAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGACGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAATC
TAATGGTCAATCGAACAGTCAAGCTAAACAACAACAAAGGCAGGACAATCCGTTTGATAACAGTGACTTTGATGACTCGT
CACTCCCGTTTTGA
ATGCTTAACAGAGTCGTATTAATAGGTCGATTAACAAAAGACCCTGAATTCAGAACAACGCAATCAGGCGTTGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATCAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGACGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAATC
TAATGGTCAATCGAACAGTCAAGCTAAACAACAACAAAGGCAGGACAATCCGTTTGATAACAGTGACTTTGATGACTCGT
CACTCCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
70.093 |
78.102 |
0.547 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.944 |
78.102 |
0.453 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
77.372 |
0.431 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.714 |
100 |
0.416 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.714 |
100 |
0.416 |
| ssbB/cilA | Streptococcus mitis SK321 |
40 |
100 |
0.409 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40 |
100 |
0.409 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40 |
100 |
0.409 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40 |
100 |
0.409 |
| ssbA | Streptococcus mutans UA159 |
39.416 |
100 |
0.394 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
40.909 |
96.35 |
0.394 |