Detailed information NTG0307376

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: L3107_RS11435
• Genome accession: NZ_CP031538
• Coordinates: 2204311..2204661 (-)
• Length: 116 a.a.
• NCBI ID: WP_050574187.1
• Uniprot ID: A0A1V0PEI8
• Organism: Lactococcus cremoris strain 3107
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2198381..2206611	2204311..2204661	within	0

Gene organization within MGE regions

Location: 2198381..2206611

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L3107_RS11395 (L3107_2226)	-	2199847..2200656 (-)	810	WP_011677177.1	metal ABC transporter permease	-
L3107_RS11400 (L3107_2227)	-	2200649..2201386 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
L3107_RS11405 (L3107_2228)	-	2201565..2202407 (-)	843	WP_021164979.1	zinc ABC transporter substrate-binding protein	-
L3107_RS11410 (L3107_2229)	-	2202404..2202841 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
L3107_RS11415	comGG	2202921..2203148 (-)	228	WP_228764408.1	competence protein ComGG	Machinery gene
L3107_RS11420 (L3107_2231)	comGF	2203244..2203690 (-)	447	WP_011836043.1	competence type IV pilus minor pilin ComGF	Machinery gene
L3107_RS11425 (L3107_2232)	comGE	2203653..2203949 (-)	297	WP_021164977.1	competence type IV pilus minor pilin ComGE	Machinery gene
L3107_RS13845 (L3107_2233)	comGD	2203921..2204109 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
L3107_RS11435 (L3107_2234)	comGC	2204311..2204661 (-)	351	WP_050574187.1	competence type IV pilus major pilin ComGC	Machinery gene
L3107_RS11440 (L3107_2235)	comGB	2204706..2205731 (-)	1026	WP_050574185.1	competence type IV pilus assembly protein ComGB	Machinery gene
L3107_RS11445 (L3107_2236)	comGA	2205631..2206611 (-)	981	WP_021164974.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 116 a.a.
• Molecular weight: 13315.52 Da
• Isoelectric Point: 7.2003

>NTDB_id=307376 L3107_RS11435 WP_050574187.1 2204311..2204661(-) (comGC) [Lactococcus cremoris strain 3107]
MIKALSLIKIHGRKLWQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD

Nucleotide

• Length: 351 bp

>NTDB_id=307376 L3107_RS11435 WP_050574187.1 2204311..2204661(-) (comGC) [Lactococcus cremoris strain 3107]
ATGATCAAAGCTTTGTCATTAATTAAAATTCACGGAAGAAAGCTTTGGCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (18-41)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	97.414	100	0.974
comYC	Streptococcus gordonii str. Challis substr. CH1	58.586	85.345	0.5
comGC/cglC	Streptococcus mitis SK321	55.882	87.931	0.491
comGC/cglC	Streptococcus pneumoniae R6	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae TIGR4	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae Rx1	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae D39	53.922	87.931	0.474
comYC	Streptococcus mutans UA140	59.14	80.172	0.474
comYC	Streptococcus mutans UA159	59.14	80.172	0.474
comGC/cglC	Streptococcus mitis NCTC 12261	55.67	83.621	0.466
comYC	Streptococcus suis isolate S10	56.818	75.862	0.431