Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | L3107_RS13845 | Genome accession | NZ_CP031538 |
| Coordinates | 2203921..2204109 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain 3107 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2198381..2206611 | 2203921..2204109 | within | 0 |
Gene organization within MGE regions
Location: 2198381..2206611
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L3107_RS11395 (L3107_2226) | - | 2199847..2200656 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| L3107_RS11400 (L3107_2227) | - | 2200649..2201386 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| L3107_RS11405 (L3107_2228) | - | 2201565..2202407 (-) | 843 | WP_021164979.1 | zinc ABC transporter substrate-binding protein | - |
| L3107_RS11410 (L3107_2229) | - | 2202404..2202841 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| L3107_RS11415 | comGG | 2202921..2203148 (-) | 228 | WP_228764408.1 | competence protein ComGG | Machinery gene |
| L3107_RS11420 (L3107_2231) | comGF | 2203244..2203690 (-) | 447 | WP_011836043.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| L3107_RS11425 (L3107_2232) | comGE | 2203653..2203949 (-) | 297 | WP_021164977.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| L3107_RS13845 (L3107_2233) | comGD | 2203921..2204109 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| L3107_RS11435 (L3107_2234) | comGC | 2204311..2204661 (-) | 351 | WP_050574187.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| L3107_RS11440 (L3107_2235) | comGB | 2204706..2205731 (-) | 1026 | WP_050574185.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| L3107_RS11445 (L3107_2236) | comGA | 2205631..2206611 (-) | 981 | WP_021164974.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=307388 L3107_RS13845 WP_014573336.1 2203921..2204109(-) (comGD) [Lactococcus cremoris strain 3107]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=307388 L3107_RS13845 WP_014573336.1 2203921..2204109(-) (comGD) [Lactococcus cremoris strain 3107]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |