Detailed information NTG0305262

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: DWB91_RS06110
• Genome accession: NZ_CP031266
• Coordinates: 1245666..1245977 (+)
• Length: 103 a.a.
• NCBI ID: WP_060552480.1
• Uniprot ID: -
• Organism: Staphylococcus agnetis strain 12B
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1240666..1250977

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DWB91_RS06080 (DWB91_06095)	-	1241442..1241645 (+)	204	WP_037567684.1	YqgQ family protein	-
DWB91_RS06085 (DWB91_06100)	-	1241642..1242628 (+)	987	WP_145051805.1	ROK family glucokinase	-
DWB91_RS06090 (DWB91_06105)	-	1242629..1242940 (+)	312	WP_060551127.1	MTH1187 family thiamine-binding protein	-
DWB91_RS06095 (DWB91_06110)	-	1242955..1243578 (+)	624	WP_107368912.1	MBL fold metallo-hydrolase	-
DWB91_RS06100 (DWB91_06115)	comGA	1243635..1244609 (+)	975	WP_060551125.1	competence type IV pilus ATPase ComGA	Machinery gene
DWB91_RS06105 (DWB91_06120)	comGB	1244578..1245645 (+)	1068	WP_107368913.1	competence type IV pilus assembly protein ComGB	-
DWB91_RS06110 (DWB91_06125)	comGC	1245666..1245977 (+)	312	WP_060552480.1	competence type IV pilus major pilin ComGC	Machinery gene
DWB91_RS06115 (DWB91_06130)	comGD	1245967..1246398 (+)	432	WP_186434576.1	competence type IV pilus minor pilin ComGD	-
DWB91_RS06120 (DWB91_06135)	-	1246590..1247072 (+)	483	WP_107368914.1	competence type IV pilus minor pilin ComGF	-
DWB91_RS11580	-	1247041..1247253 (+)	213	WP_171509143.1	hypothetical protein	-
DWB91_RS06125 (DWB91_06140)	-	1247192..1247761 (+)	570	WP_107368917.1	shikimate kinase	-
DWB91_RS06130 (DWB91_06145)	gcvT	1247913..1249004 (+)	1092	WP_060551123.1	glycine cleavage system aminomethyltransferase GcvT	-
DWB91_RS06135 (DWB91_06150)	gcvPA	1249016..1250365 (+)	1350	WP_060551122.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11494.66 Da
• Isoelectric Point: 9.0689

>NTDB_id=305262 DWB91_RS06110 WP_060552480.1 1245666..1245977(+) (comGC) [Staphylococcus agnetis strain 12B]
MIHMLKNKKGFTLIEMLLVLLIISVLLILIIPNIAKQSEHIQKTGCAAQLKLVDSQIEAYTLKYNRKPATIEELVQEGYI
KENQKNCKSGESITIRGGEAIAS

Nucleotide

• Length: 312 bp

>NTDB_id=305262 DWB91_RS06110 WP_060552480.1 1245666..1245977(+) (comGC) [Staphylococcus agnetis strain 12B]
ATGATTCACATGCTAAAAAATAAAAAAGGATTCACGCTAATTGAAATGTTGCTTGTATTACTGATTATTAGCGTTTTATT
AATTTTAATTATCCCAAACATAGCTAAACAATCTGAACACATTCAAAAAACAGGATGTGCTGCACAACTTAAACTTGTTG
ACAGTCAAATAGAAGCATATACATTAAAATACAATCGTAAACCAGCAACTATAGAAGAACTTGTTCAAGAAGGTTATATT
AAGGAGAATCAAAAGAATTGTAAAAGTGGTGAAAGCATCACAATCCGTGGTGGCGAGGCTATTGCATCGTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	68.932	100	0.689
comGC	Staphylococcus aureus MW2	68.932	100	0.689
comGC	Bacillus subtilis subsp. subtilis str. 168	44.086	90.291	0.398
comYC	Streptococcus suis isolate S10	52.632	73.786	0.388
comYC	Streptococcus gordonii str. Challis substr. CH1	50.633	76.699	0.388
comGC/cglC	Streptococcus mitis SK321	51.316	73.786	0.379
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	73.786	0.379
comGC/cglC	Streptococcus pneumoniae R6	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae TIGR4	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae Rx1	50	73.786	0.369
comGC/cglC	Streptococcus pneumoniae D39	50	73.786	0.369
comYC	Streptococcus mutans UA140	48.101	76.699	0.369
comYC	Streptococcus mutans UA159	48.101	76.699	0.369