Detailed information NTG0304013

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: DV527_RS06595
• Genome accession: NZ_CP031196
• Coordinates: 1336159..1336470 (+)
• Length: 103 a.a.
• NCBI ID: WP_037538386.1
• Uniprot ID: A0A380HKV5
• Organism: Staphylococcus saprophyticus strain 1A
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1331159..1341470

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DV527_RS06565 (DV527_06580)	-	1331897..1332094 (+)	198	WP_041080619.1	YqgQ family protein	-
DV527_RS06570 (DV527_06585)	-	1332098..1333084 (+)	987	WP_145437537.1	glucokinase	-
DV527_RS06575 (DV527_06590)	-	1333084..1333410 (+)	327	WP_002483185.1	MTH1187 family thiamine-binding protein	-
DV527_RS06580 (DV527_06595)	-	1333410..1334033 (+)	624	WP_145437538.1	MBL fold metallo-hydrolase	-
DV527_RS06585 (DV527_06600)	comGA	1334121..1335095 (+)	975	WP_011303021.1	competence type IV pilus ATPase ComGA	Machinery gene
DV527_RS06590 (DV527_06605)	comGB	1335067..1336131 (+)	1065	WP_041080625.1	competence type IV pilus assembly protein ComGB	-
DV527_RS06595 (DV527_06610)	comGC	1336159..1336470 (+)	312	WP_037538386.1	competence type IV pilus major pilin ComGC	Machinery gene
DV527_RS13415 (DV527_06615)	-	1336493..1336906 (+)	414	WP_052463703.1	hypothetical protein	-
DV527_RS06610 (DV527_06625)	comGF	1337164..1337607 (+)	444	WP_002483191.1	competence type IV pilus minor pilin ComGF	-
DV527_RS06620 (DV527_06635)	-	1337811..1338284 (+)	474	WP_002483192.1	shikimate kinase	-
DV527_RS06625 (DV527_06640)	gcvT	1338468..1339559 (+)	1092	WP_041080630.1	glycine cleavage system aminomethyltransferase GcvT	-
DV527_RS06630 (DV527_06645)	gcvPA	1339577..1340929 (+)	1353	WP_011303028.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11386.52 Da
• Isoelectric Point: 9.5858

>NTDB_id=304013 DV527_RS06595 WP_037538386.1 1336159..1336470(+) (comGC) [Staphylococcus saprophyticus strain 1A]
MKKLKINRKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHLQNTGCEAQLKMIDSQIEAYALKFNKKPSSIEDLVTEGYI
KENQKSCKSGAAITINNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=304013 DV527_RS06595 WP_037538386.1 1336159..1336470(+) (comGC) [Staphylococcus saprophyticus strain 1A]
ATGAAAAAACTAAAAATTAATAGAAAAGCTTTTACATTAATAGAAATGTTACTTGTATTATTGATAATTAGCTTATTATT
AATATTAATTATACCCAATATAGCTAAACAATCGTCTCACTTGCAAAATACTGGATGTGAGGCACAACTTAAAATGATTG
ATAGCCAAATTGAAGCGTATGCTTTAAAGTTTAATAAAAAGCCATCGTCTATAGAAGACTTAGTTACAGAAGGATACATT
AAAGAAAATCAAAAGTCATGTAAATCTGGTGCAGCCATCACTATTAACAATGGTGAAGCTGTTGCAAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (7-30)

3D structure

• AlphaFold DB: A0A380HKV5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	77.895	92.233	0.718
comGC	Staphylococcus aureus N315	77.895	92.233	0.718
comYC	Streptococcus gordonii str. Challis substr. CH1	43.81	100	0.447
comGC/cglC	Streptococcus mitis NCTC 12261	40.777	100	0.408
comYC	Streptococcus mutans UA159	48.837	83.495	0.408
comYC	Streptococcus mutans UA140	48.837	83.495	0.408
comGC	Bacillus subtilis subsp. subtilis str. 168	42.553	91.262	0.388
comGC/cglC	Streptococcus mitis SK321	46.429	81.553	0.379
comYC	Streptococcus suis isolate S10	45.882	82.524	0.379
comGC/cglC	Streptococcus pneumoniae R6	45.238	81.553	0.369
comGC/cglC	Streptococcus pneumoniae D39	45.238	81.553	0.369
comGC/cglC	Streptococcus pneumoniae Rx1	45.238	81.553	0.369
comGC/cglC	Streptococcus pneumoniae TIGR4	45.238	81.553	0.369