Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ETA19_RS12475 Genome accession   NZ_CP035401
Coordinates   2420853..2421236 (-) Length   127 a.a.
NCBI ID   WP_029317913.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM103837     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2415853..2426236
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETA19_RS12435 (ETA19_12435) sinI 2416786..2416959 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ETA19_RS12440 (ETA19_12440) sinR 2416993..2417328 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ETA19_RS12445 (ETA19_12445) tasA 2417421..2418206 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ETA19_RS12450 (ETA19_12450) sipW 2418270..2418842 (-) 573 WP_128993656.1 signal peptidase I SipW -
  ETA19_RS12455 (ETA19_12455) tapA 2418826..2419587 (-) 762 WP_128993152.1 amyloid fiber anchoring/assembly protein TapA -
  ETA19_RS12460 (ETA19_12460) yqzG 2419859..2420185 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ETA19_RS12465 (ETA19_12465) spoIITA 2420227..2420406 (-) 180 WP_014480252.1 YqzE family protein -
  ETA19_RS12470 (ETA19_12470) comGG 2420478..2420852 (-) 375 WP_128993153.1 ComG operon protein ComGG Machinery gene
  ETA19_RS12475 (ETA19_12475) comGF 2420853..2421236 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  ETA19_RS12480 (ETA19_12480) comGE 2421262..2421609 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ETA19_RS12485 (ETA19_12485) comGD 2421593..2422024 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  ETA19_RS12490 (ETA19_12490) comGC 2422014..2422310 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  ETA19_RS12495 (ETA19_12495) comGB 2422324..2423361 (-) 1038 WP_128993154.1 comG operon protein ComGB Machinery gene
  ETA19_RS12500 (ETA19_12500) comGA 2423348..2424418 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ETA19_RS12510 (ETA19_12510) corA 2424830..2425783 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14363.43 Da        Isoelectric Point: 5.8949

>NTDB_id=299507 ETA19_RS12475 WP_029317913.1 2420853..2421236(-) (comGF) [Bacillus subtilis strain SRCM103837]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=299507 ETA19_RS12475 WP_029317913.1 2420853..2421236(-) (comGF) [Bacillus subtilis strain SRCM103837]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGATATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment