Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DP112_RS09810 | Genome accession | NZ_CP030125 |
| Coordinates | 1984306..1984722 (-) | Length | 138 a.a. |
| NCBI ID | WP_114866882.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain HA1003 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1959780..1997659 | 1984306..1984722 | within | 0 |
Gene organization within MGE regions
Location: 1959780..1997659
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DP112_RS09665 (DP112_09670) | - | 1960051..1960242 (+) | 192 | WP_099776205.1 | helix-turn-helix transcriptional regulator | - |
| DP112_RS09670 (DP112_09675) | - | 1960326..1961732 (-) | 1407 | WP_114866868.1 | peptidoglycan amidohydrolase family protein | - |
| DP112_RS09675 (DP112_09680) | - | 1961820..1962062 (-) | 243 | WP_044667800.1 | phage holin | - |
| DP112_RS09680 (DP112_09685) | - | 1962068..1962346 (-) | 279 | WP_024387693.1 | hypothetical protein | - |
| DP112_RS11105 | - | 1962350..1962505 (-) | 156 | WP_161940742.1 | hypothetical protein | - |
| DP112_RS09685 (DP112_09690) | - | 1962525..1962959 (-) | 435 | WP_074390439.1 | DUF1366 domain-containing protein | - |
| DP112_RS09690 (DP112_09695) | - | 1962972..1965029 (-) | 2058 | WP_114866869.1 | DUF859 family phage minor structural protein | - |
| DP112_RS09695 (DP112_09700) | - | 1965043..1968522 (-) | 3480 | WP_114866870.1 | phage tail spike protein | - |
| DP112_RS09700 (DP112_09705) | - | 1968519..1969199 (-) | 681 | WP_164503931.1 | distal tail protein Dit | - |
| DP112_RS09705 (DP112_09710) | - | 1969257..1972661 (-) | 3405 | WP_114866872.1 | phage tail tape measure protein | - |
| DP112_RS11425 | - | 1972674..1972808 (-) | 135 | WP_261308516.1 | hypothetical protein | - |
| DP112_RS09710 (DP112_09715) | - | 1972880..1973212 (-) | 333 | WP_024411098.1 | hypothetical protein | - |
| DP112_RS09715 (DP112_09720) | - | 1973225..1973815 (-) | 591 | WP_105242587.1 | phage tail protein | - |
| DP112_RS09720 (DP112_09725) | - | 1973826..1974248 (-) | 423 | WP_024406275.1 | hypothetical protein | - |
| DP112_RS09725 (DP112_09730) | - | 1974253..1974624 (-) | 372 | WP_024411095.1 | hypothetical protein | - |
| DP112_RS09730 (DP112_09735) | - | 1974587..1974964 (-) | 378 | WP_024406273.1 | hypothetical protein | - |
| DP112_RS09735 (DP112_09740) | - | 1974957..1975256 (-) | 300 | WP_114866873.1 | phage head-tail connector protein | - |
| DP112_RS09740 (DP112_09745) | - | 1975271..1975558 (-) | 288 | WP_114866874.1 | HeH/LEM domain-containing protein | - |
| DP112_RS09745 (DP112_09750) | - | 1975576..1976766 (-) | 1191 | WP_114866875.1 | phage major capsid protein | - |
| DP112_RS09750 (DP112_09755) | - | 1976772..1977461 (-) | 690 | WP_024406269.1 | head maturation protease, ClpP-related | - |
| DP112_RS09755 (DP112_09760) | - | 1977439..1978698 (-) | 1260 | WP_114866876.1 | phage portal protein | - |
| DP112_RS09760 (DP112_09765) | - | 1978728..1978979 (-) | 252 | WP_114866877.1 | hypothetical protein | - |
| DP112_RS09765 (DP112_09770) | - | 1978989..1980641 (-) | 1653 | WP_044758401.1 | terminase TerL endonuclease subunit | - |
| DP112_RS09770 (DP112_09775) | - | 1980625..1980972 (-) | 348 | WP_024406265.1 | hypothetical protein | - |
| DP112_RS11430 (DP112_09780) | - | 1981095..1981424 (-) | 330 | WP_114866878.1 | HNH endonuclease | - |
| DP112_RS09780 (DP112_09785) | - | 1981421..1981711 (-) | 291 | WP_114866879.1 | hypothetical protein | - |
| DP112_RS09785 (DP112_09790) | - | 1981878..1982453 (-) | 576 | WP_024406262.1 | tyrosine-type recombinase/integrase | - |
| DP112_RS09790 (DP112_09795) | - | 1982582..1983046 (-) | 465 | WP_024414945.1 | hypothetical protein | - |
| DP112_RS11110 | - | 1983098..1983250 (-) | 153 | WP_164503932.1 | hypothetical protein | - |
| DP112_RS11115 | - | 1983219..1983368 (-) | 150 | WP_164503933.1 | hypothetical protein | - |
| DP112_RS09795 (DP112_09800) | - | 1983382..1983777 (-) | 396 | WP_114866880.1 | hypothetical protein | - |
| DP112_RS09800 (DP112_09805) | - | 1983761..1984030 (-) | 270 | WP_114866881.1 | hypothetical protein | - |
| DP112_RS09805 (DP112_09810) | - | 1984027..1984296 (-) | 270 | WP_044758399.1 | hypothetical protein | - |
| DP112_RS09810 (DP112_09815) | ssb | 1984306..1984722 (-) | 417 | WP_114866882.1 | single-stranded DNA-binding protein | Machinery gene |
| DP112_RS09815 (DP112_09820) | - | 1984719..1984985 (-) | 267 | WP_114866883.1 | hypothetical protein | - |
| DP112_RS09820 (DP112_09825) | - | 1984982..1985185 (-) | 204 | WP_105248998.1 | hypothetical protein | - |
| DP112_RS11120 | - | 1985186..1985362 (-) | 177 | WP_164503934.1 | hypothetical protein | - |
| DP112_RS09825 (DP112_09830) | - | 1985362..1985766 (-) | 405 | WP_114866884.1 | YopX family protein | - |
| DP112_RS09830 (DP112_09835) | - | 1985906..1986388 (-) | 483 | WP_164503935.1 | DUF1642 domain-containing protein | - |
| DP112_RS09835 (DP112_09840) | - | 1986381..1986737 (-) | 357 | WP_114866886.1 | hypothetical protein | - |
| DP112_RS09840 (DP112_09845) | - | 1986748..1987422 (-) | 675 | WP_114866887.1 | DNA methyltransferase | - |
| DP112_RS09845 (DP112_09850) | - | 1987415..1988857 (-) | 1443 | WP_241146856.1 | DNA cytosine methyltransferase | - |
| DP112_RS11125 | - | 1988978..1989151 (-) | 174 | WP_164503936.1 | hypothetical protein | - |
| DP112_RS09850 (DP112_09855) | - | 1989196..1989945 (-) | 750 | WP_024412313.1 | site-specific DNA-methyltransferase | - |
| DP112_RS09855 (DP112_09860) | - | 1989935..1990114 (-) | 180 | WP_105202375.1 | hypothetical protein | - |
| DP112_RS11130 | - | 1990114..1990281 (-) | 168 | WP_153309147.1 | hypothetical protein | - |
| DP112_RS09860 (DP112_09865) | - | 1990281..1990472 (-) | 192 | WP_024406249.1 | hypothetical protein | - |
| DP112_RS09865 (DP112_09870) | - | 1990459..1991427 (-) | 969 | WP_024406248.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DP112_RS11135 | - | 1991417..1991575 (-) | 159 | WP_153309197.1 | hypothetical protein | - |
| DP112_RS09870 (DP112_09875) | - | 1991578..1991832 (-) | 255 | WP_114866888.1 | hypothetical protein | - |
| DP112_RS09875 (DP112_09880) | - | 1991834..1992016 (-) | 183 | WP_114866889.1 | hypothetical protein | - |
| DP112_RS09880 (DP112_09885) | - | 1992013..1992297 (-) | 285 | WP_114866890.1 | DNA-binding protein | - |
| DP112_RS09885 (DP112_09890) | - | 1992340..1992684 (-) | 345 | WP_114866891.1 | hypothetical protein | - |
| DP112_RS11140 | - | 1992681..1992830 (-) | 150 | WP_164503890.1 | hypothetical protein | - |
| DP112_RS09890 (DP112_09895) | - | 1992808..1993005 (-) | 198 | WP_024405319.1 | hypothetical protein | - |
| DP112_RS09895 (DP112_09900) | - | 1993085..1993792 (+) | 708 | WP_114866892.1 | hypothetical protein | - |
| DP112_RS09900 (DP112_09905) | - | 1993786..1994058 (-) | 273 | WP_114866893.1 | hypothetical protein | - |
| DP112_RS09905 (DP112_09910) | - | 1994133..1994384 (+) | 252 | WP_114866894.1 | hypothetical protein | - |
| DP112_RS09910 (DP112_09915) | - | 1994379..1994576 (-) | 198 | WP_114866895.1 | hypothetical protein | - |
| DP112_RS09915 (DP112_09920) | - | 1994643..1994843 (-) | 201 | WP_002937001.1 | helix-turn-helix transcriptional regulator | - |
| DP112_RS09920 (DP112_09925) | - | 1995029..1995409 (+) | 381 | WP_114866896.1 | helix-turn-helix transcriptional regulator | - |
| DP112_RS09925 (DP112_09930) | - | 1995416..1995802 (+) | 387 | WP_114866897.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DP112_RS09930 (DP112_09935) | - | 1995854..1996456 (+) | 603 | WP_114866898.1 | CD20-like domain-containing protein | - |
| DP112_RS09935 (DP112_09940) | - | 1996589..1997659 (+) | 1071 | WP_114866899.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15771.60 Da Isoelectric Point: 5.7350
>NTDB_id=299505 DP112_RS09810 WP_114866882.1 1984306..1984722(-) (ssb) [Streptococcus suis strain HA1003]
MINNVVLVGRLTRDVELRYTPSNQAVATFTLAVNRNFKNQSTGEREADFINCVMWRQQAENLANWTKKGHLIGITGRIQT
RSYENQQGQRVYVTEVVAESFQVFEKRDNTANHTSMEDQMPPNFSGPTMDINDDGLPF
MINNVVLVGRLTRDVELRYTPSNQAVATFTLAVNRNFKNQSTGEREADFINCVMWRQQAENLANWTKKGHLIGITGRIQT
RSYENQQGQRVYVTEVVAESFQVFEKRDNTANHTSMEDQMPPNFSGPTMDINDDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=299505 DP112_RS09810 WP_114866882.1 1984306..1984722(-) (ssb) [Streptococcus suis strain HA1003]
ATGATAAATAATGTTGTATTGGTTGGTAGATTGACGAGGGACGTAGAGCTACGTTATACACCGTCTAATCAAGCTGTTGC
GACTTTTACTTTGGCGGTTAACCGCAATTTTAAAAATCAATCGACAGGAGAGCGGGAAGCTGACTTTATCAATTGCGTGA
TGTGGCGACAGCAGGCTGAGAATTTAGCCAACTGGACTAAGAAAGGTCATCTGATTGGTATTACAGGTCGAATTCAGACC
AGAAGCTATGAAAATCAGCAAGGGCAACGTGTCTACGTTACTGAGGTTGTTGCAGAAAGTTTCCAGGTATTTGAAAAGCG
TGATAACACTGCTAATCATACAAGCATGGAAGACCAAATGCCACCCAATTTCAGCGGTCCTACAATGGATATCAATGATG
ACGGATTGCCGTTTTAG
ATGATAAATAATGTTGTATTGGTTGGTAGATTGACGAGGGACGTAGAGCTACGTTATACACCGTCTAATCAAGCTGTTGC
GACTTTTACTTTGGCGGTTAACCGCAATTTTAAAAATCAATCGACAGGAGAGCGGGAAGCTGACTTTATCAATTGCGTGA
TGTGGCGACAGCAGGCTGAGAATTTAGCCAACTGGACTAAGAAAGGTCATCTGATTGGTATTACAGGTCGAATTCAGACC
AGAAGCTATGAAAATCAGCAAGGGCAACGTGTCTACGTTACTGAGGTTGTTGCAGAAAGTTTCCAGGTATTTGAAAAGCG
TGATAACACTGCTAATCATACAAGCATGGAAGACCAAATGCCACCCAATTTCAGCGGTCCTACAATGGATATCAATGATG
ACGGATTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.575 |
100 |
0.638 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
73.148 |
78.261 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.944 |
77.536 |
0.449 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.553 |
100 |
0.435 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.844 |
100 |
0.428 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
51.351 |
80.435 |
0.413 |
| ssbA | Streptococcus mutans UA159 |
45.946 |
80.435 |
0.37 |