Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DMR38_RS20905 | Genome accession | NZ_CP029758 |
| Coordinates | 4447751..4448158 (-) | Length | 135 a.a. |
| NCBI ID | WP_127723583.1 | Uniprot ID | - |
| Organism | Clostridium sp. AWRP | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4415494..4456274 | 4447751..4448158 | within | 0 |
Gene organization within MGE regions
Location: 4415494..4456274
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DMR38_RS20710 (DMR38_20740) | - | 4415494..4415814 (+) | 321 | WP_063557014.1 | hypothetical protein | - |
| DMR38_RS20715 (DMR38_20745) | - | 4416002..4416298 (-) | 297 | WP_243124382.1 | CPBP family intramembrane glutamic endopeptidase | - |
| DMR38_RS20720 (DMR38_20750) | - | 4416295..4416636 (-) | 342 | WP_127723519.1 | hypothetical protein | - |
| DMR38_RS22040 | - | 4416680..4416889 (+) | 210 | WP_127723521.1 | hypothetical protein | - |
| DMR38_RS22465 | - | 4417105..4417473 (+) | 369 | WP_243124383.1 | transposase | - |
| DMR38_RS20740 (DMR38_20770) | - | 4418187..4418837 (-) | 651 | WP_243124385.1 | DUF4352 domain-containing protein | - |
| DMR38_RS20745 (DMR38_20775) | - | 4418952..4419164 (-) | 213 | WP_127723523.1 | DNA-binding protein | - |
| DMR38_RS22045 | - | 4419359..4419496 (-) | 138 | WP_175413080.1 | hypothetical protein | - |
| DMR38_RS20750 (DMR38_20780) | - | 4419624..4420175 (-) | 552 | WP_127723525.1 | hypothetical protein | - |
| DMR38_RS20755 (DMR38_20785) | - | 4420178..4420993 (-) | 816 | WP_127723527.1 | GH25 family lysozyme | - |
| DMR38_RS20760 (DMR38_20790) | - | 4421006..4421269 (-) | 264 | WP_127723529.1 | hemolysin XhlA family protein | - |
| DMR38_RS22050 | - | 4421312..4422238 (-) | 927 | WP_175413081.1 | hypothetical protein | - |
| DMR38_RS20770 (DMR38_20800) | - | 4422250..4422957 (-) | 708 | WP_127723531.1 | hypothetical protein | - |
| DMR38_RS22165 (DMR38_20805) | - | 4422970..4423917 (-) | 948 | WP_127723533.1 | hypothetical protein | - |
| DMR38_RS20780 (DMR38_20810) | - | 4423940..4424482 (-) | 543 | WP_127723535.1 | hypothetical protein | - |
| DMR38_RS20785 (DMR38_20815) | - | 4424472..4426148 (-) | 1677 | WP_127723537.1 | phage tail spike protein | - |
| DMR38_RS20790 (DMR38_20820) | - | 4426148..4426870 (-) | 723 | WP_127723539.1 | distal tail protein Dit | - |
| DMR38_RS20795 (DMR38_20825) | - | 4426872..4431359 (-) | 4488 | WP_127723541.1 | phage tail tape measure protein | - |
| DMR38_RS20800 (DMR38_20830) | - | 4431359..4431553 (-) | 195 | WP_127723543.1 | hypothetical protein | - |
| DMR38_RS20805 (DMR38_20835) | - | 4431670..4432038 (-) | 369 | WP_127723545.1 | hypothetical protein | - |
| DMR38_RS20810 (DMR38_20840) | - | 4432087..4432980 (-) | 894 | WP_127723547.1 | SwmB domain-containing protein | - |
| DMR38_RS20815 (DMR38_20845) | - | 4432987..4433268 (-) | 282 | WP_243124386.1 | hypothetical protein | - |
| DMR38_RS20820 (DMR38_20850) | - | 4433367..4433747 (-) | 381 | WP_127723549.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DMR38_RS20825 (DMR38_20855) | - | 4433737..4434057 (-) | 321 | WP_127723551.1 | hypothetical protein | - |
| DMR38_RS20830 (DMR38_20860) | - | 4434057..4434371 (-) | 315 | WP_127723553.1 | phage head-tail connector protein | - |
| DMR38_RS20835 (DMR38_20865) | - | 4434402..4434635 (-) | 234 | WP_127723555.1 | Rho termination factor N-terminal domain-containing protein | - |
| DMR38_RS20840 (DMR38_20870) | - | 4434635..4435558 (-) | 924 | WP_127723557.1 | hypothetical protein | - |
| DMR38_RS20845 (DMR38_20875) | - | 4435574..4436170 (-) | 597 | WP_127723559.1 | DUF4355 domain-containing protein | - |
| DMR38_RS20850 (DMR38_20880) | - | 4436310..4436546 (-) | 237 | WP_127723561.1 | hypothetical protein | - |
| DMR38_RS20855 (DMR38_20885) | - | 4436548..4437807 (-) | 1260 | WP_175413082.1 | minor capsid protein | - |
| DMR38_RS20860 (DMR38_20890) | - | 4437785..4439143 (-) | 1359 | WP_127723566.1 | phage portal protein | - |
| DMR38_RS20865 (DMR38_20895) | - | 4439156..4440877 (-) | 1722 | WP_127723568.1 | hypothetical protein | - |
| DMR38_RS20870 (DMR38_20900) | - | 4440883..4441122 (-) | 240 | WP_175413083.1 | hypothetical protein | - |
| DMR38_RS20875 (DMR38_20905) | - | 4441192..4441689 (-) | 498 | WP_127723572.1 | hypothetical protein | - |
| DMR38_RS20880 (DMR38_20910) | - | 4441700..4442485 (-) | 786 | WP_127723574.1 | endonuclease/exonuclease/phosphatase family protein | - |
| DMR38_RS20885 (DMR38_20915) | - | 4442749..4443153 (-) | 405 | WP_127723576.1 | helix-turn-helix domain-containing protein | - |
| DMR38_RS20890 (DMR38_20920) | - | 4443298..4443720 (-) | 423 | WP_127723578.1 | RNA polymerase subunit sigma | - |
| DMR38_RS22060 | - | 4443738..4443878 (-) | 141 | WP_175413084.1 | hypothetical protein | - |
| DMR38_RS20895 (DMR38_20925) | - | 4444164..4446749 (-) | 2586 | WP_127723580.1 | CHC2 zinc finger domain-containing protein | - |
| DMR38_RS22065 | - | 4446787..4446927 (-) | 141 | WP_175413085.1 | hypothetical protein | - |
| DMR38_RS20900 (DMR38_20930) | - | 4446924..4447514 (-) | 591 | WP_175413151.1 | ERCC4 domain-containing protein | - |
| DMR38_RS20905 (DMR38_20935) | ssb | 4447751..4448158 (-) | 408 | WP_127723583.1 | single-stranded DNA-binding protein | Machinery gene |
| DMR38_RS20910 (DMR38_20940) | - | 4448171..4448791 (-) | 621 | WP_127723585.1 | HD domain-containing protein | - |
| DMR38_RS20915 (DMR38_20945) | bet | 4448805..4449749 (-) | 945 | WP_127723587.1 | phage recombination protein Bet | - |
| DMR38_RS20920 (DMR38_20950) | - | 4449749..4451428 (-) | 1680 | WP_127723589.1 | DNA repair protein | - |
| DMR38_RS20925 (DMR38_20955) | - | 4451444..4451668 (-) | 225 | WP_127723591.1 | hypothetical protein | - |
| DMR38_RS20930 (DMR38_20960) | - | 4451720..4452220 (-) | 501 | WP_127723593.1 | helix-turn-helix transcriptional regulator | - |
| DMR38_RS22070 | - | 4452279..4452446 (-) | 168 | WP_175413086.1 | hypothetical protein | - |
| DMR38_RS20935 (DMR38_20965) | - | 4452443..4452631 (-) | 189 | WP_127723595.1 | hypothetical protein | - |
| DMR38_RS20940 (DMR38_20970) | - | 4452771..4453034 (-) | 264 | WP_127723597.1 | hypothetical protein | - |
| DMR38_RS20945 (DMR38_20975) | - | 4453051..4453251 (-) | 201 | WP_243124387.1 | hypothetical protein | - |
| DMR38_RS22080 | - | 4453254..4453406 (-) | 153 | WP_175413088.1 | hypothetical protein | - |
| DMR38_RS20950 (DMR38_20980) | - | 4453393..4453581 (-) | 189 | WP_127723599.1 | hypothetical protein | - |
| DMR38_RS22085 | - | 4453578..4453748 (-) | 171 | WP_175413089.1 | hypothetical protein | - |
| DMR38_RS20955 (DMR38_20985) | - | 4453839..4454072 (-) | 234 | WP_127723601.1 | helix-turn-helix domain-containing protein | - |
| DMR38_RS20960 (DMR38_20990) | - | 4454254..4454643 (+) | 390 | WP_127723603.1 | helix-turn-helix transcriptional regulator | - |
| DMR38_RS20965 (DMR38_20995) | - | 4454669..4455112 (+) | 444 | WP_127723605.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DMR38_RS20970 (DMR38_21000) | - | 4455105..4456274 (+) | 1170 | WP_127723607.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 135 a.a. Molecular weight: 15154.88 Da Isoelectric Point: 4.7719
>NTDB_id=295942 DMR38_RS20905 WP_127723583.1 4447751..4448158(-) (ssb) [Clostridium sp. AWRP]
MNRVILIGRLTKDPDLQFLPGNGTAVTKFTLAVDRRFKKEGQQEADFVPIVVWNKQAESAANYLTKGKLAGIAGRIQTRN
YEAKDGTKRYVTEVIAEEVQFLEWGDKVSNNSSQNNQQSNNADYVEVEDDGDIPF
MNRVILIGRLTKDPDLQFLPGNGTAVTKFTLAVDRRFKKEGQQEADFVPIVVWNKQAESAANYLTKGKLAGIAGRIQTRN
YEAKDGTKRYVTEVIAEEVQFLEWGDKVSNNSSQNNQQSNNADYVEVEDDGDIPF
Nucleotide
Download Length: 408 bp
>NTDB_id=295942 DMR38_RS20905 WP_127723583.1 4447751..4448158(-) (ssb) [Clostridium sp. AWRP]
TTGAATAGAGTTATTTTAATAGGAAGATTAACCAAAGATCCTGACTTGCAGTTTTTACCCGGCAATGGGACAGCAGTAAC
AAAGTTTACATTAGCAGTTGATAGAAGGTTTAAAAAAGAAGGACAGCAGGAAGCTGATTTTGTACCTATAGTGGTTTGGA
ATAAGCAAGCTGAGAGTGCTGCCAATTATTTAACTAAAGGTAAATTAGCAGGAATTGCAGGGAGAATTCAAACAAGAAAT
TATGAGGCAAAAGATGGTACTAAAAGATATGTTACTGAAGTTATTGCAGAAGAGGTTCAATTCTTAGAATGGGGAGATAA
AGTAAGTAATAATTCAAGTCAAAATAATCAACAAAGTAATAATGCTGATTATGTAGAAGTTGAGGACGACGGGGATATAC
CATTCTGA
TTGAATAGAGTTATTTTAATAGGAAGATTAACCAAAGATCCTGACTTGCAGTTTTTACCCGGCAATGGGACAGCAGTAAC
AAAGTTTACATTAGCAGTTGATAGAAGGTTTAAAAAAGAAGGACAGCAGGAAGCTGATTTTGTACCTATAGTGGTTTGGA
ATAAGCAAGCTGAGAGTGCTGCCAATTATTTAACTAAAGGTAAATTAGCAGGAATTGCAGGGAGAATTCAAACAAGAAAT
TATGAGGCAAAAGATGGTACTAAAAGATATGTTACTGAAGTTATTGCAGAAGAGGTTCAATTCTTAGAATGGGGAGATAA
AGTAAGTAATAATTCAAGTCAAAATAATCAACAAAGTAATAATGCTGATTATGTAGAAGTTGAGGACGACGGGGATATAC
CATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
39.766 |
100 |
0.504 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.926 |
100 |
0.459 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.615 |
77.037 |
0.459 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.963 |
100 |
0.43 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.222 |
100 |
0.422 |
| ssbA | Streptococcus mutans UA159 |
42.222 |
100 |
0.422 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.481 |
100 |
0.415 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.481 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.481 |
100 |
0.415 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.481 |
100 |
0.415 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.923 |
77.037 |
0.4 |