Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DLM82_RS01220 | Genome accession | NZ_CP029749 |
| Coordinates | 199712..200107 (+) | Length | 131 a.a. |
| NCBI ID | WP_000282447.1 | Uniprot ID | A0AAV3JLT6 |
| Organism | Streptococcus agalactiae strain PLGBS13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 191317..241875 | 199712..200107 | within | 0 |
Gene organization within MGE regions
Location: 191317..241875
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DLM82_RS01160 (DLM82_01160) | - | 192108..193301 (+) | 1194 | WP_000047534.1 | acetate kinase | - |
| DLM82_RS01165 (DLM82_01165) | - | 193453..193659 (+) | 207 | WP_000798241.1 | helix-turn-helix transcriptional regulator | - |
| DLM82_RS01170 (DLM82_01170) | - | 193718..193855 (+) | 138 | WP_001865900.1 | hypothetical protein | - |
| DLM82_RS01175 (DLM82_01175) | - | 193896..194351 (+) | 456 | WP_000905673.1 | hypothetical protein | - |
| DLM82_RS01180 (DLM82_01180) | - | 194420..195085 (+) | 666 | WP_000008113.1 | CPBP family intramembrane glutamic endopeptidase | - |
| DLM82_RS01185 (DLM82_01185) | proC | 195106..195876 (-) | 771 | WP_001865901.1 | pyrroline-5-carboxylate reductase | - |
| DLM82_RS01190 (DLM82_01190) | pepA | 195946..197013 (-) | 1068 | WP_001281323.1 | glutamyl aminopeptidase | - |
| DLM82_RS01195 (DLM82_01195) | - | 197198..197437 (-) | 240 | WP_000660180.1 | hypothetical protein | - |
| DLM82_RS01200 (DLM82_01200) | - | 197598..197882 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| DLM82_RS01205 (DLM82_01205) | - | 197879..198202 (+) | 324 | WP_000602781.1 | thioredoxin family protein | - |
| DLM82_RS01210 (DLM82_01210) | ytpR | 198235..198861 (+) | 627 | WP_000578328.1 | YtpR family tRNA-binding protein | - |
| DLM82_RS01215 (DLM82_01215) | - | 198915..199631 (-) | 717 | WP_000186185.1 | class I SAM-dependent methyltransferase | - |
| DLM82_RS01220 (DLM82_01220) | ssbA | 199712..200107 (+) | 396 | WP_000282447.1 | single-stranded DNA-binding protein | Machinery gene |
| DLM82_RS01225 (DLM82_01225) | - | 200231..200875 (+) | 645 | WP_000416612.1 | HAD family phosphatase | - |
| DLM82_RS01230 (DLM82_01230) | - | 200902..202647 (+) | 1746 | WP_000930334.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| DLM82_RS01235 (DLM82_01235) | - | 202628..203368 (+) | 741 | WP_000697630.1 | LytTR family DNA-binding domain-containing protein | - |
| DLM82_RS01240 (DLM82_01240) | - | 203538..203993 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| DLM82_RS01245 (DLM82_01245) | lrgB | 203995..204723 (+) | 729 | WP_000421726.1 | antiholin-like protein LrgB | - |
| DLM82_RS01255 (DLM82_01255) | - | 204966..206594 (+) | 1629 | WP_000170504.1 | ABC transporter substrate-binding protein | - |
| DLM82_RS01260 (DLM82_01260) | - | 206707..207684 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| DLM82_RS01265 (DLM82_01265) | - | 207681..208502 (+) | 822 | WP_000603397.1 | ABC transporter permease | - |
| DLM82_RS01270 (DLM82_01270) | - | 208514..209317 (+) | 804 | WP_000140984.1 | ABC transporter ATP-binding protein | - |
| DLM82_RS01275 (DLM82_01275) | - | 209301..209927 (+) | 627 | WP_000171311.1 | ABC transporter ATP-binding protein | - |
| DLM82_RS01280 (DLM82_01280) | treP | 210210..212240 (+) | 2031 | WP_000434616.1 | PTS system trehalose-specific EIIBC component | - |
| DLM82_RS01285 (DLM82_01285) | treC | 212462..214087 (+) | 1626 | WP_000151017.1 | alpha,alpha-phosphotrehalase | - |
| DLM82_RS01290 (DLM82_01290) | - | 214303..216339 (+) | 2037 | WP_000228180.1 | BglG family transcription antiterminator | - |
| DLM82_RS01295 (DLM82_01295) | - | 216342..216626 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| DLM82_RS01300 (DLM82_01300) | - | 216639..217994 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| DLM82_RS01305 (DLM82_01305) | - | 217997..218854 (+) | 858 | WP_000203489.1 | transketolase | - |
| DLM82_RS01310 (DLM82_01310) | - | 218851..219780 (+) | 930 | WP_001203821.1 | transketolase family protein | - |
| DLM82_RS01315 (DLM82_01315) | - | 219889..221148 (+) | 1260 | WP_001203071.1 | ferric reductase-like transmembrane domain-containing protein | - |
| DLM82_RS01320 (DLM82_01320) | rpsO | 221236..221505 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| DLM82_RS01325 (DLM82_01325) | pnp | 221886..224015 (+) | 2130 | WP_000043850.1 | polyribonucleotide nucleotidyltransferase | - |
| DLM82_RS01330 (DLM82_01330) | - | 224017..224769 (+) | 753 | WP_000204782.1 | SseB family protein | - |
| DLM82_RS01335 (DLM82_01335) | cysE | 224778..225362 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| DLM82_RS01340 (DLM82_01340) | - | 225372..225554 (+) | 183 | WP_000656476.1 | lipoprotein | - |
| DLM82_RS01345 (DLM82_01345) | cysS | 225551..226894 (+) | 1344 | WP_000591125.1 | cysteine--tRNA ligase | - |
| DLM82_RS01350 (DLM82_01350) | - | 226887..227273 (+) | 387 | WP_000568029.1 | Mini-ribonuclease 3 | - |
| DLM82_RS01355 (DLM82_01355) | rlmB | 227376..228131 (+) | 756 | WP_000178026.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| DLM82_RS01360 (DLM82_01360) | - | 228128..228646 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| DLM82_RS01365 (DLM82_01365) | - | 228739..229599 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| DLM82_RS11060 (DLM82_01375) | - | 230136..230255 (+) | 120 | Protein_210 | helix-turn-helix transcriptional regulator | - |
| DLM82_RS01380 (DLM82_01380) | rplM | 230480..230926 (+) | 447 | WP_001865567.1 | 50S ribosomal protein L13 | - |
| DLM82_RS01385 (DLM82_01385) | rpsI | 230947..231339 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| DLM82_RS01395 (DLM82_01395) | - | 231467..232621 (-) | 1155 | WP_000022165.1 | site-specific integrase | - |
| DLM82_RS01400 (DLM82_01400) | - | 232685..233275 (-) | 591 | WP_000181098.1 | helix-turn-helix domain-containing protein | - |
| DLM82_RS01405 (DLM82_01405) | - | 233430..233735 (+) | 306 | WP_000331954.1 | hypothetical protein | - |
| DLM82_RS01410 (DLM82_01410) | - | 233871..234149 (+) | 279 | WP_000134670.1 | hypothetical protein | - |
| DLM82_RS01415 (DLM82_01415) | - | 234160..234390 (+) | 231 | WP_000360142.1 | hypothetical protein | - |
| DLM82_RS01420 (DLM82_01420) | - | 234403..234729 (+) | 327 | WP_000384270.1 | replication initiator protein A | - |
| DLM82_RS01425 (DLM82_01425) | - | 234733..235362 (+) | 630 | WP_000591148.1 | hypothetical protein | - |
| DLM82_RS01430 (DLM82_01430) | - | 235675..236550 (+) | 876 | WP_000770113.1 | hypothetical protein | - |
| DLM82_RS01435 (DLM82_01435) | - | 236586..237020 (+) | 435 | WP_001220479.1 | hypothetical protein | - |
| DLM82_RS01440 (DLM82_01440) | mobV | 237336..238592 (+) | 1257 | WP_000122832.1 | MobV family relaxase | - |
| DLM82_RS01445 (DLM82_01445) | - | 238760..239230 (+) | 471 | WP_000130119.1 | hypothetical protein | - |
| DLM82_RS01450 (DLM82_01450) | - | 239535..239870 (-) | 336 | WP_000384858.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DLM82_RS01455 (DLM82_01455) | - | 239860..240147 (-) | 288 | WP_000255538.1 | hypothetical protein | - |
| DLM82_RS01460 (DLM82_01460) | - | 240550..241770 (-) | 1221 | WP_000156558.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14774.80 Da Isoelectric Point: 7.0189
>NTDB_id=295827 DLM82_RS01220 WP_000282447.1 199712..200107(+) (ssbA) [Streptococcus agalactiae strain PLGBS13]
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
MYNKVIMIGRLTAKPEMVKTPTDKSVTRATVAVNRRFKGSNGEREADFINVVMWGRLAETLASYGTKGSLISIDGELRTR
KYEKDGQTHYITEVLASSFQLLESRAQRAMRENNVSGDLSDLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=295827 DLM82_RS01220 WP_000282447.1 199712..200107(+) (ssbA) [Streptococcus agalactiae strain PLGBS13]
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
ATGTATAATAAAGTTATTATGATTGGGCGTCTAACAGCAAAGCCTGAGATGGTAAAAACACCAACTGACAAGTCAGTGAC
GCGTGCAACTGTTGCTGTTAATAGACGCTTTAAAGGAAGTAATGGTGAGCGTGAAGCAGATTTTATTAATGTGGTTATGT
GGGGTCGTCTAGCGGAAACCCTTGCGAGCTATGGGACAAAGGGCTCTTTAATTTCAATAGATGGTGAATTGCGTACGCGC
AAGTACGAAAAGGATGGTCAAACGCACTATATCACTGAAGTATTAGCATCATCATTTCAGTTGCTAGAAAGCCGTGCCCA
ACGTGCTATGCGTGAAAATAACGTTTCTGGTGATTTGTCAGATTTAGTATTGGAAGAAGAGGAGCTCCCCTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Streptococcus mutans UA159 |
80.916 |
100 |
0.809 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
77.863 |
100 |
0.779 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
77.099 |
100 |
0.771 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
77.099 |
100 |
0.771 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
76.336 |
100 |
0.763 |
| ssbB/cilA | Streptococcus mitis SK321 |
76.336 |
100 |
0.763 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
60.526 |
87.023 |
0.527 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.018 |
86.26 |
0.397 |